DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fadd and Fadd

DIOPT Version :9

Sequence 1:NP_651006.1 Gene:Fadd / 42594 FlyBaseID:FBgn0038928 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_034305.1 Gene:Fadd / 14082 MGIID:109324 Length:205 Species:Mus musculus


Alignment Length:210 Identity:46/210 - (21%)
Similarity:85/210 - (40%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISGNMPQLIEALSAYTKPEN 90
            :||.:..|.: |:|:.:.:::..||...|...::|.       |..:|.:.:|:.:|..:     
Mouse    22 ELKFLCRERV-SKRKLERVQSGLDLFTVLLEQNDLE-------RGHTGLLRELLASLRRH----- 73

  Fly    91 ILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHKRTMVF 155
                  :|.|.|...|        |..:..|.|..::|..|                       |
Mouse    74 ------DLLQRLDDFE--------AGTATAAPPGEADLQVA-----------------------F 101

  Fly   156 KKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQILRLLQLIEEDDCHDPKHFLLRLCRA 220
            ..:.:.:||.|:||.|...:.|.:||.|||:||..|..::...|::.:..:..:..  :..|.:|
Mouse   102 DIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNAS--VAGLVKA 164

  Fly   221 LGDCGRNDLRKRVEQ 235
            |..|..|.:...||:
Mouse   165 LRTCRLNLVADLVEE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaddNP_651006.1 DD 22..>71 CDD:301326 10/44 (23%)
Death 154..234 CDD:260017 22/79 (28%)
FaddNP_034305.1 DED_FADD 2..83 CDD:260043 13/60 (22%)
Death_FADD 97..181 CDD:260020 18/83 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..205 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12263
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15077
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.