DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fadd and fadd

DIOPT Version :9

Sequence 1:NP_651006.1 Gene:Fadd / 42594 FlyBaseID:FBgn0038928 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_002934114.2 Gene:fadd / 100379789 XenbaseID:XB-GENE-1001300 Length:188 Species:Xenopus tropicalis


Alignment Length:220 Identity:47/220 - (21%)
Similarity:82/220 - (37%) Gaps:55/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EQLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISG--NMPQLIEALSAY-T 86
            |...|.|:.....:::.:.:|:..||...|....|:|..||:.|.::.|  |...|:..::.| |
 Frog    18 ELSSLKFLRRDLGKKKLEGVRSATDLFSLLLERQEISGENVDYLIQLLGSINRHDLVAEVADYKT 82

  Fly    87 KPENILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHKR 151
            |.....|                     ||.:|....              .:||          
 Frog    83 KCIGSTG---------------------APGTQERDS--------------LDYA---------- 102

  Fly   152 TMVFKKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQILRLLQLIEEDDCHDPKHFLLR 216
               |..|.:.:||.|:.|.|..|:.:..:|.|....|::::.|:.|.|:  ...|....:..:..
 Frog   103 ---FDVICDNVGRDWKMLVRRLGVSDVTIDRIVGANPNNMREQLYRCLR--SWKDNMGERANMEN 162

  Fly   217 LCRALGDCGRNDLRKRV--EQIMSH 239
            |.:||.:|....:|.:|  :|...|
 Frog   163 LLQALLNCKMKLVRDKVLEKQSSGH 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaddNP_651006.1 DD 22..>71 CDD:301326 12/45 (27%)
Death 154..234 CDD:260017 21/81 (26%)
faddXP_002934114.2 DED_FADD 1..81 CDD:260043 15/62 (24%)
DD 99..183 CDD:417479 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619689at2759
OrthoFinder 1 1.000 - - FOG0008143
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15077
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.