DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and dNK

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_565032.2 Gene:dNK / 843535 AraportID:AT1G72040 Length:580 Species:Arabidopsis thaliana


Alignment Length:335 Identity:76/335 - (22%)
Similarity:121/335 - (36%) Gaps:94/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLIYINSYGYDMRKLDPQLPPSCRSYDVRNFCLD 150
            ||||.|:.|||.|.:.:|.|       .|:|.         |:.::.|:  |..:..||     .
plant   269 CVEGNISVGKSTFLQRIANE-------TVELQ---------DLVEIVPE--PVDKWQDV-----G 310

  Fly   151 PSHDLAAQFQI--------RMYMLRYSQY--IDALQHVLSTGQGV----VLERSPYSD-FVFMEA 200
            |.|     |.|        :.|...:..|  :..|.....:..||    ::|||.:|| .||:.|
plant   311 PDH-----FNILDAFYSEPQRYAYTFQNYVFVTRLMQEKESASGVKPLRLMERSVFSDRMVFVRA 370

  Fly   201 MFRQGYLSRGARSVYNELRQNTIGEL--LKPHLVIYLDLPVDAVKKQIKARNVDYEVQSKVFSDA 263
            :....:::....|:|:......:..|  |.|...|||....|...|::..|.   ..:....|..
plant   371 VHEAKWMNEMEISIYDSWFDPVVSSLPGLVPDGFIYLRASPDTCHKRMMLRK---RAEEGGVSLK 432

  Fly   264 YLSDLEQLYKQQYL------------------KDISTHAELLIYDWTAGG--------ETEVVVE 302
            ||.||.:.::...|                  .|.|.|.::....:...|        :...:|.
plant   433 YLQDLHEKHESWLLPFESGNHGVLSVSRPSLHMDNSLHPDIKDRVFYLEGNHMHSSIQKVPALVL 497

  Fly   303 DIE-RIDFNQFEADIHNKKMLDWRFPLEAEWCEARIKYCHEK-----PDLMNYFN---------- 351
            |.| .|||::   ||..|.....:.....|:.:.:.:...||     |.|:.:.|          
plant   498 DCEPNIDFSR---DIEAKTQYARQVAEFFEFVKKKQETSTEKSNSQSPVLLPHQNGGLWMGPAGN 559

  Fly   352 -VPRFDVPEL 360
             ||..|:|.|
plant   560 HVPGLDLPPL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 59/265 (22%)
dNKNP_565032.2 NT_Pol-beta-like <179..>249 CDD:386233
dNK 268..456 CDD:238836 52/217 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.