DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and dnk

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster


Alignment Length:256 Identity:58/256 - (22%)
Similarity:109/256 - (42%) Gaps:64/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLI------YINSYGYDMRKL---DPQLPPSCR 140
            :.:||.|.:||:.:...      .|.|.. |:.|:      :.|..|.::.:|   ||:      
  Fly    23 VLIEGNIGSGKTTYLNH------FEKYKN-DICLLTEPVEKWRNVNGVNLLELMYKDPK------ 74

  Fly   141 SYDVRNFCLDPSHDLAAQFQ--IRMYMLRYSQYIDALQHVLSTGQGV-VLERSPYS-DFVFMEAM 201
                         ..|..||  :.:.||:        .|...|.:.: ::|||.:| .:.|:|.|
  Fly    75 -------------KWAMPFQSYVTLTMLQ--------SHTAPTNKKLKIMERSIFSARYCFVENM 118

  Fly   202 FRQGYLSRGARSVYNELRQ--NTIGELL--KPHLVIYLDLPVDAVKKQI--KARNVDYEVQSKVF 260
            .|.|.|.:|   :||.|.:  ..|.|.:  :..|:|||....:...::|  :||:.:..|..|  
  Fly   119 RRNGSLEQG---MYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLK-- 178

  Fly   261 SDAYLSDLEQLYKQQYLKDISTHA-ELLIYDWTAGGETEVVVEDIERIDFNQFEADIHNKK 320
               ||.:|.:|::...:......: ::|:.|  |....|.:..:.:|.:.:.|:|...|::
  Fly   179 ---YLQELHELHEDWLIHQRRPQSCKVLVLD--ADLNLENIGTEYQRSESSIFDAISSNQQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 55/242 (23%)
dnkNP_001262722.1 dNK 23..214 CDD:238836 54/234 (23%)
DTMP_kinase 23..214 CDD:161676 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10513
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.