DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and Dguok

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_008761278.1 Gene:Dguok / 297389 RGDID:1304799 Length:365 Species:Rattus norvegicus


Alignment Length:352 Identity:75/352 - (21%)
Similarity:118/352 - (33%) Gaps:108/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NAIFDKTSKRFDENS---KVICVEGPIAAGKSKFAKELAEELDMEYYPAVD-------------- 115
            ||:.|....|...:.   :.:|:||.||.|||.|.| |..:...|:..|.:              
  Rat    21 NALVDAPRARGMHDGGGPRRLCIEGNIAVGKSTFVK-LLTKTHPEWQVATEPIATWQNVQAAGTQ 84

  Fly   116 -----------LDLIYIN----SYGYD----MRKLDPQLPPSCRSYDVRNFCLDPSHDLAAQFQI 161
                       ||::|..    ||.:.    |.:|..||.|:            |...|.|...:
  Rat    85 KDSTSRRLGNLLDMMYQEPARWSYTFQTLSFMSRLKVQLEPT------------PGRLLQADTSV 137

  Fly   162 R-----MYMLRYSQYIDALQ--HVLSTGQGVVLERSP---------------------------Y 192
            |     :|..|.|..:.:.|  ..||.|.|.:....|                           |
  Rat   138 RVFERSVYSDRASSMVPSRQARGPLSQGLGQLSSSYPSGQLHCAALARQDQLFCSHGLEDSSPNY 202

  Fly   193 SDFVFMEAMFRQGYLSRGARSVYNELRQNTIGEL---LKPHLVIYLDLPVDAVKKQIKARNVDYE 254
            ..::|.:.:|..|.||.....:|.:.....:.|.   |..|..|||........:::..|..:.|
  Rat   203 CRYIFAKNLFENGSLSDVEWHIYQDWHSFLLQEFEDRLLLHGFIYLQASPQVCMERLCQRGREEE 267

  Fly   255 VQSKVFSDAYLSDLEQLYKQQYL-KDISTHAELLIYDWTAGGETEVVVEDIERIDFNQFEA---D 315
               |....|||..|...::..:: |....|.|.|.:       ..|:|.:|.. ||::..|   :
  Rat   268 ---KGIELAYLKQLHGQHEDWFINKTTKLHFEALRH-------VPVLVLNISE-DFSENAAKQEE 321

  Fly   316 IHNKKMLDWRF-----PLEAEW--CEA 335
            :..:....|..     .|.:.|  |:|
  Rat   322 LMGQVSRAWLLLVPSAELSSSWSLCQA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 63/294 (21%)
DguokXP_008761278.1 dNK 41..326 CDD:279974 66/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.