DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and DGUOK

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_550438.1 Gene:DGUOK / 1716 HGNCID:2858 Length:277 Species:Homo sapiens


Alignment Length:270 Identity:61/270 - (22%)
Similarity:107/270 - (39%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PYKTKKYSVFNAIFDKTSKRFDENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLIYIN 122
            |:.:...|....:............:.:.:||.||.|||.|.|.|.:... |::.|.:....:.|
Human    14 PFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYP-EWHVATEPVATWQN 77

  Fly   123 SYGYDMRKLDPQLPPSCRSYDVRNFCLDPSHDLAAQ----FQIRMYMLRYSQYIDAL-QHVLSTG 182
            ......:|       :|.:..:.|. ||..:...|:    ||...::.|....::.. :.:|...
Human    78 IQAAGTQK-------ACTAQSLGNL-LDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQAR 134

  Fly   183 QGV-VLERSPYSD-FVFMEAMFRQGYLSRGARSVYNELRQNTIGEL---LKPHLVIYLDLPVDAV 242
            :.| :.|||.||| ::|.:.:|..|.||.....:|.:.....:.|.   :..|..|||.......
Human   135 KPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVC 199

  Fly   243 KKQI--KARNVDYEVQSKVFSDAYLSDLEQLYKQQYL----KDISTHAELLIYDWTAGGETEVVV 301
            .|::  :||..:..::        |:.||||:.|...    |....|.|.|:       ...|:|
Human   200 LKRLYQRAREEEKGIE--------LAYLEQLHGQHEAWLIHKTTKLHFEALM-------NIPVLV 249

  Fly   302 EDIERIDFNQ 311
            .|:.. ||::
Human   250 LDVND-DFSE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 57/239 (24%)
DGUOKNP_550438.1 dNK 41..275 CDD:279974 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.