DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and DCK

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_000779.1 Gene:DCK / 1633 HGNCID:2704 Length:260 Species:Homo sapiens


Alignment Length:251 Identity:56/251 - (22%)
Similarity:101/251 - (40%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KVICVEGPIAAGKSKFA---KELAEELDMEYYPAVDLDLIYINSYGYDMRKLDPQLPPSCRSYDV 144
            |.|.:||.||||||.|.   |:|.|  |.|..|........:.|...:..:|...   .....:|
Human    22 KKISIEGNIAAGKSTFVNILKQLCE--DWEVVPEPVARWCNVQSTQDEFEELTMS---QKNGGNV 81

  Fly   145 RNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVL--ERSPYSD-FVFMEAMFRQGY 206
            .....:.....:..||....:.|....:.:|...|...:..||  |||.||| ::|...::....
Human    82 LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESEC 146

  Fly   207 LSRGARSVY---NELRQNTIGELLKPHLVIYLDLPVDAVKKQI--KARNVDYEVQSKVFSDAYLS 266
            ::....::|   ::...|..|:.|:...:|||....:....:|  :.||.:..:..:     ||.
Human   147 MNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLE-----YLE 206

  Fly   267 DLEQLYKQQYL-KDISTHAELLIYDWTAGGETEVVVEDIERIDF-NQFEADIHNKK 320
            .|...::...| :.:.|:.:.|       .|..::..|:.. || :::|:.:...|
Human   207 KLHYKHESWLLHRTLKTNFDYL-------QEVPILTLDVNE-DFKDKYESLVEKVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 51/235 (22%)
DCKNP_000779.1 dNK 24..258 CDD:279974 55/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.