DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-42 and Dck

DIOPT Version :9

Sequence 1:NP_001262821.1 Gene:ND-42 / 42591 FlyBaseID:FBgn0019957 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_031858.1 Gene:Dck / 13178 MGIID:102726 Length:260 Species:Mus musculus


Alignment Length:240 Identity:55/240 - (22%)
Similarity:96/240 - (40%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KRF-------DENSKV--ICVEGPIAAGKSKFA---KELAEELDMEYYPAVDLDLIYINSYGYDM 128
            |||       .|.:::  |.:||.||||||.|.   |:.:|  |.|..|........:.|...:.
Mouse     6 KRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQASE--DWEVVPEPVARWCNVQSTQEEF 68

  Fly   129 RKLDPQLPPSCRS-YDVRNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVL--ERS 190
            .    :|..|.:| .:|.....:.....:..||....:.|....:.:|...|...:..||  |||
Mouse    69 E----ELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAEKPVLFFERS 129

  Fly   191 PYSD-FVFMEAMFRQGYLSRGARSVY---NELRQNTIGELLKPHLVIYLDLPVDAVKKQI--KAR 249
            .||| ::|...::....::....::|   ::...:..|:.|:...:|||....:....:|  :.|
Mouse   130 VYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRATPEKCLNRIYLRGR 194

  Fly   250 NVDYEVQSKVFSDAYLSDLEQL-YKQQ-------------YLKDI 280
            |.:..:.        |..||:| ||.:             ||:::
Mouse   195 NEEQGIP--------LEYLEKLHYKHESWLLHRTLKTSFDYLQEV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-42NP_001262821.1 NDUO42 84..308 CDD:238988 51/225 (23%)
DckNP_031858.1 dNK 24..258 CDD:279974 51/222 (23%)
Tmk 24..257 CDD:223203 51/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.