DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cchl and hccsa.2

DIOPT Version :9

Sequence 1:NP_001262820.1 Gene:Cchl / 42590 FlyBaseID:FBgn0038925 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_017208122.2 Gene:hccsa.2 / 101882578 ZFINID:ZDB-GENE-090501-4 Length:293 Species:Danio rerio


Alignment Length:144 Identity:85/144 - (59%)
Similarity:100/144 - (69%) Gaps:11/144 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ECPMHQKHGD-AKSASAVPPHPKMQAA-SECPVQHDN------SDVNPLNMMPPANQQPAADQPF 90
            ||||||...| .|.|..||.|...... .|||::..|      ||:||.|||||.||||:|||||
Zfish   153 ECPMHQASKDHTKKAPDVPAHQDRACEFVECPMRAANGTKPTLSDINPANMMPPPNQQPSADQPF 217

  Fly    91 PLPTDRQTSTIPKVTEDGSVQFWQYPSQQMFWNAMLRKGWRWKTEDVSQKDMGDIIRIHNANNEQ 155
            ||...|:.||||:.   |:.:.|.|||:||||||||||||||...|::|.||||||:|||.||||
Zfish   218 PLSVVREESTIPRA---GAERNWVYPSEQMFWNAMLRKGWRWNKGDINQNDMGDIIKIHNQNNEQ 279

  Fly   156 AWQEVLKWEALHAK 169
            ||||:|:||.||:|
Zfish   280 AWQEILRWEKLHSK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CchlNP_001262820.1 Cyto_heme_lyase 13..260 CDD:279589 85/144 (59%)
hccsa.2XP_017208122.2 PKc_like <2..99 CDD:328722
Cyto_heme_lyase 143..>293 CDD:307431 84/142 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282808at2759
OrthoFinder 1 1.000 - - FOG0003033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1787
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.