DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and AT1G12050

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_172669.2 Gene:AT1G12050 / 837757 AraportID:AT1G12050 Length:421 Species:Arabidopsis thaliana


Alignment Length:405 Identity:90/405 - (22%)
Similarity:143/405 - (35%) Gaps:156/405 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GDLAKRLGLLSEDQKSLVEFAGL-EGVPSDLKILIAQD------PNLEELA-------KKA---- 61
            |||...|..:||        ||| :|       ||.:|      |||.:..       |:|    
plant    41 GDLVLDLSAISE--------AGLFDG-------LILKDADCFLQPNLNKFLAMGRPAWKEARSTL 90

  Fly    62 -----EKQPRLEVND-----------DVTLLPPL-----TDPGKIICIGLNYQDHC-----DEQN 100
                 ..:|.|..||           .|.::.|:     ||    ....:::..:|     ..:|
plant    91 QRILSSNEPILRDNDVLRRKSFHQMSKVEMIVPMVIGDYTD----FFASMHHAKNCGLMFRGPEN 151

  Fly   101 KPTP---KEPLFFSKFNNALV-------------GPQDNVIAH-AASSKIDWEVELVCVIG---K 145
            ...|   :.|:.:....:::|             .||.|...: ..|.|:|:|:|:..|:|   :
plant   152 AINPNWFRLPIAYHGRASSIVISGTDIIRPRGQGHPQGNSEPYFGPSKKLDFELEMAAVVGPGNE 216

  Fly   146 VARQVPKSQAMDYVFGYSVAQDISARD---WQKERNGGQFLMGKS-----------MDTFLPLG- 195
            :.:.:..:.|.|::||..:..|.||||   |:....|.  .:|||           :|...|.| 
plant   217 LGKPIDVNNAADHIFGLLLMNDWSARDIQAWEYVPLGP--FLGKSFGTTISPWIVTLDALEPFGC 279

  Fly   196 ----------PAVVHKSLVPDVYNLNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTIT----- 245
                      |.:..|..|.  |:::|:..:    |.:|...:.:....:..| |..|||     
plant   280 QAPKQDPPPLPYLAEKESVN--YDISLEVQL----KPSGRDDSCVITKSNFQN-LYWTITQQLAH 337

  Fly   246 -------LLPGDIIVTGTPKG-------------------VGMHRTPPEFLQPGDVV-------- 276
                   |.|||::.|||..|                   :.::.|...||:.||.|        
plant   338 HTVNGCNLRPGDLLGTGTISGPEPDSYGCLLELTWNGQKPLSLNGTTQTFLEDGDQVTFSGVCKG 402

  Fly   277 QSEIVGLGKLCNKIV 291
            ....||.|....|||
plant   403 DGYNVGFGTCTGKIV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 82/383 (21%)
FAA_hydrolase 86..290 CDD:279845 61/292 (21%)
AT1G12050NP_172669.2 PLN02856 1..421 CDD:215461 90/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.