DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and AT4G15940

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_193329.1 Gene:AT4G15940 / 827276 AraportID:AT4G15940 Length:222 Species:Arabidopsis thaliana


Alignment Length:206 Identity:80/206 - (38%)
Similarity:122/206 - (59%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KIICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNV-IAHAASSKIDWEVELVCVIGKVA 147
            ||:|:|.||..|..|.....||||:.|.|..::.:.....: |.|...| :..||||..|||:.|
plant    15 KIVCVGRNYAAHAKELGNAVPKEPVIFLKPTSSYLENGGTIEIPHPLDS-LHHEVELALVIGQKA 78

  Fly   148 RQVPKSQAMDYVFGYSVAQDISARDWQ--KERNGGQFLMGKSMDTFLPLGPAVVHKSLVPDVYNL 210
            |.||:|.||||:.||:||.|::||:.|  .:.:|..:.:.|..|||.|:. :|:.|::|.|..||
plant    79 RDVPESIAMDYIGGYAVALDMTARELQASAKASGLPWTVAKGQDTFTPIS-SVLPKAMVRDPDNL 142

  Fly   211 NLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEFLQPGDV 275
            .|...|:|..:|.|.|.::|||:..:|:.:|..:||. ||:|:||||:|||.       ::.|..
plant   143 ELWLKVDGETRQKGLTKDMIFKVPYLISYISSIMTLY-GDVILTGTPEGVGP-------VKIGQK 199

  Fly   276 VQSEIVGLGKL 286
            :.:.|.||.::
plant   200 ITAGITGLSEV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 80/206 (39%)
FAA_hydrolase 86..290 CDD:279845 78/204 (38%)
AT4G15940NP_193329.1 MhpD <15..209 CDD:223257 80/203 (39%)
FAA_hydrolase 17..214 CDD:279845 78/204 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.