DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and FAHD1

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001018114.2 Gene:FAHD1 / 81889 HGNCID:14169 Length:245 Species:Homo sapiens


Alignment Length:204 Identity:78/204 - (38%)
Similarity:114/204 - (55%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GK-IICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVIGKV 146
            || |:|:|.||.||..|.......||:.|.|.:.|.......::..|.:..:..|:||..|:||.
Human    14 GKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKR 78

  Fly   147 ARQVPKSQAMDYVFGYSVAQDISARDWQKE--RNGGQFLMGKSMDTFLPLGPAVVHKSLVPDVYN 209
            .|.||::.|||||.||::..|::|||.|.|  :.|..:.:.||.....|:. |.|.|..:||.:.
Human    79 CRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVS-AFVPKEKIPDPHK 142

  Fly   210 LNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEFLQPGD 274
            |.|...|||..:|.|.|.::||.:..:|:.:|:.|||..||||:||||||||.       ::..|
Human   143 LKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGP-------VKEND 200

  Fly   275 VVQSEIVGL 283
            .:::.|.||
Human   201 EIEAGIHGL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 78/204 (38%)
FAA_hydrolase 86..290 CDD:279845 75/200 (38%)
FAHD1NP_001018114.2 MhpD <16..209 CDD:223257 74/200 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.