DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and Fahd1

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_075969.1 Gene:Fahd1 / 68636 MGIID:1915886 Length:227 Species:Mus musculus


Alignment Length:211 Identity:76/211 - (36%)
Similarity:117/211 - (55%) Gaps:11/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GK-IICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVIGKV 146
            || |:|:|.||.||..|.......||:.|.|.:.|.......|:..|....:..||||..::||.
Mouse    20 GKNIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGKR 84

  Fly   147 ARQVPKSQAMDYVFGYSVAQDISARDWQKE--RNGGQFLMGKSMDTFLPLGPAVVHKSLVPDVYN 209
            ...:|::.|||||.||::..|::|||.|:|  :.|..:.:.||..:..|:. |.|.|..:||.:.
Mouse    85 GEAIPEAAAMDYVAGYALCLDMTARDVQEECKKKGLPWTLAKSFTSSCPVS-AFVPKEKIPDPHA 148

  Fly   210 LNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEFLQPGD 274
            |.|...|||..:|.|.|.::||.:..:|:.:|:.|||..||:|:||||||||.       ::..|
Mouse   149 LRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGP-------IKEND 206

  Fly   275 VVQSEIVGLGKLCNKI 290
            .:::.|.|:..:..|:
Mouse   207 EIEAGIDGVVSMRFKV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 76/211 (36%)
FAA_hydrolase 86..290 CDD:279845 72/205 (35%)
Fahd1NP_075969.1 MhpD <22..226 CDD:223257 74/209 (35%)
FAA_hydrolase 24..222 CDD:279845 72/205 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.