DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and Faa

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster


Alignment Length:186 Identity:39/186 - (20%)
Similarity:66/186 - (35%) Gaps:63/186 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ASSKIDWEVELVCVIGKVARQVPK----SQAMDYVFGYSVAQDISARDWQKERNGGQFLMGKSMD 189
            |...:|:|:|:...||....|:.:    .:|...|||:::..|.||||.||..            
  Fly   189 ACKLLDFELEMAFFIGGKGNQLGEPIRVDEAWKNVFGFTLMNDWSARDIQKWE------------ 241

  Fly   190 TFLPLGPAVVHKSL-----------------------------------VPDVYNLNLKTWVNGV 219
             ::||||... |:|                                   :|..:::||:..:...
  Fly   242 -YVPLGPFTA-KNLGTTISPWVVPTAALKPFVLDNFPQEPEVLPYLRQNIPFNFDINLEVSLKPA 304

  Fly   220 EKQNGNTGNLIFK------LDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEF 269
            ::.........||      |..:.:.......|.|||::.:||..|    .||..:
  Fly   305 DQNEALISKSNFKHLYWTPLQQIAHHTVTGCNLRPGDLMASGTISG----ETPDSY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 39/186 (21%)
FAA_hydrolase 86..290 CDD:279845 39/186 (21%)
FaaNP_524830.2 PLN02856 1..414 CDD:215461 39/186 (21%)
FAA_hydrolase_N 17..115 CDD:286391
FAA_hydrolase 121..409 CDD:279845 39/186 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463743
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.