DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and CG5793

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001247225.2 Gene:CG5793 / 42505 FlyBaseID:FBgn0038858 Length:220 Species:Drosophila melanogaster


Alignment Length:217 Identity:81/217 - (37%)
Similarity:122/217 - (56%) Gaps:12/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LTDPGKIICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVI 143
            |::..||:.:.|||.|....:|.|.|||||.|.|..::.:.....::.....:|:.:||||..||
  Fly    12 LSNGKKIVGVALNYMDVVLARNVPVPKEPLVFLKPTSSYLQEGQPIVLPKVFTKVAYEVELGVVI 76

  Fly   144 GKVARQVPKSQAMDYVFGYSVAQDISAR-DWQKERNGGQ-FLMGKSMDTFLPLGPAV-VHKSLVP 205
            ||..:.|.|:.||.||.||.:|.|::|: :....|..|. :.:||..||..|:...: :.|  |.
  Fly    77 GKPCKNVSKADAMSYVAGYCLALDLTAQCNLGPARAAGHPWTLGKGFDTSTPVSQFIPIEK--VT 139

  Fly   206 DVYNLNLKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEFL 270
            |.:||.|...|||..||||.|.:||||:.|:|:.:|:.:||...|:|:||||.|.       :..
  Fly   140 DPHNLPLWLTVNGDLKQNGCTADLIFKVPDIISYVSKYMTLEANDLILTGTPNGA-------DAF 197

  Fly   271 QPGDVVQSEIVGLGKLCNKIVA 292
            :.|||:|..:..|.||..::.|
  Fly   198 KAGDVIQCGMADLAKLTFQVEA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 81/217 (37%)
FAA_hydrolase 86..290 CDD:279845 77/206 (37%)
CG5793NP_001247225.2 MhpD <17..220 CDD:223257 80/212 (38%)
FAA_hydrolase 19..217 CDD:279845 77/206 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.