DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and fah

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_021333072.1 Gene:fah / 322372 ZFINID:ZDB-GENE-030131-1091 Length:446 Species:Danio rerio


Alignment Length:275 Identity:61/275 - (22%)
Similarity:93/275 - (33%) Gaps:119/275 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVIG---KVARQVPKSQAMDYVF 160
            |.:|...:|..|        ||         |.::|.|:|:...:|   |:...:|..:|.:::|
Zfish   207 QMRPDAAQPPIF--------GP---------SKQLDIELEMAFFVGKGNKLGEPIPIEKAHEHIF 254

  Fly   161 GYSVAQDISARD---WQKERNGGQFLMGKSMDTFLPLGP-------------AVVHKSLVPDV-- 207
            |..:..|.||||   |:                ::||||             .|..::|:|.|  
Zfish   255 GMVIMNDWSARDIQAWE----------------YVPLGPFLGKNFGTTISPWVVPMEALMPFVEP 303

  Fly   208 -------------------YNLNLKTWVNGVEKQNGNT---GNLIFK------LDDVINRLSQTI 244
                               :|:||...|.|...:...|   .|  ||      ...:.:......
Zfish   304 NPVQDPVPLPYLRHDDPYTFNINLFVSVKGEGMREATTICKSN--FKHMYWSMKQQLAHHTVNGC 366

  Fly   245 TLLPGDIIVTGT-----PK------------------GVGMHRTPPEFLQPGDVV--------QS 278
            .:.|||::.:||     |:                  |.|..||   ||:.||.|        |.
Zfish   367 NVRPGDLLASGTISGPDPESFGSMLELSWRGTKTIDLGGGETRT---FLKDGDEVTLSGYCEGQG 428

  Fly   279 EIVGLGKLCNKIVAP 293
            ..||.| ||...:.|
Zfish   429 FRVGFG-LCEGKILP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 60/273 (22%)
FAA_hydrolase 86..290 CDD:279845 60/270 (22%)
fahXP_021333072.1 fum_ac_acetase 30..444 CDD:162276 61/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.