Sequence 1: | NP_651002.3 | Gene: | CG6028 / 42589 | FlyBaseID: | FBgn0038924 | Length: | 293 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333072.1 | Gene: | fah / 322372 | ZFINID: | ZDB-GENE-030131-1091 | Length: | 446 | Species: | Danio rerio |
Alignment Length: | 275 | Identity: | 61/275 - (22%) |
---|---|---|---|
Similarity: | 93/275 - (33%) | Gaps: | 119/275 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 QNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVIG---KVARQVPKSQAMDYVF 160
Fly 161 GYSVAQDISARD---WQKERNGGQFLMGKSMDTFLPLGP-------------AVVHKSLVPDV-- 207
Fly 208 -------------------YNLNLKTWVNGVEKQNGNT---GNLIFK------LDDVINRLSQTI 244
Fly 245 TLLPGDIIVTGT-----PK------------------GVGMHRTPPEFLQPGDVV--------QS 278
Fly 279 EIVGLGKLCNKIVAP 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6028 | NP_651002.3 | MhpD | 37..293 | CDD:223257 | 60/273 (22%) |
FAA_hydrolase | 86..290 | CDD:279845 | 60/270 (22%) | ||
fah | XP_021333072.1 | fum_ac_acetase | 30..444 | CDD:162276 | 61/275 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |