DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and Fah

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_058877.1 Gene:Fah / 29383 RGDID:61932 Length:419 Species:Rattus norvegicus


Alignment Length:370 Identity:84/370 - (22%)
Similarity:124/370 - (33%) Gaps:124/370 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DQKSLVEFAGL------EGVPSDLKILIAQDPNLEELAKKAEKQPRLEVNDDVTLLPPLTDPGKI 85
            |:.:|..|.||      |...|...:|.|....|.:  .|..:|.........|:..|.|     
  Rat    63 DETTLNSFMGLGQAAWKEARASLQNLLSASQAQLRD--DKELRQRAFTSQASATMHLPAT----- 120

  Fly    86 ICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALV-----------GPQDNVI-------------- 125
              || :|.|........|....:|..| .|||:           |...:|:              
  Rat   121 --IG-DYTDFYSSLQHATNVGIMFRGK-ENALLPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMR 181

  Fly   126 -------AHAASSKIDWEVELVCVIG---KVARQVPKSQAMDYVFGYSVAQDISARDWQKERNG- 179
                   .:.||.::|.|:|:...:|   :....:|.|:|.:::||..:..|.||||.|:.... 
  Rat   182 PDNSKPPVYGASKRLDMELEMAFFVGPGNRFGEPIPISKAQEHIFGMVLMNDWSARDIQQWEYVP 246

  Fly   180 -GQFLMGKS-----------MDTFLPLG-----------PAVVHKSLVPDVYNLNLKTWVNGVEK 221
             |.|| |||           ||..:|..           |.:.|..  |..:::||...:.|...
  Rat   247 LGPFL-GKSFGTTISPWVVPMDALMPFVVPNPKQDPKPLPYLCHSQ--PYTFDINLSVALKGEGM 308

  Fly   222 QNGNT---GNLIFK------LDDVINRLSQTITLLPGDIIVTGT-----PK-------------- 258
            ....|   .|  ||      |..:.:.......|.|||::.:||     |:              
  Rat   309 SQAATICRSN--FKHMYWTILQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWKGTK 371

  Fly   259 ----GVGMHRTPPEFLQPGDVV--------QSEIVGLGKLCNKIV 291
                |.|..||   ||..||.|        ....||.|:...|::
  Rat   372 AIDVGQGQTRT---FLLDGDEVIITGHCQGDGYRVGFGQCAGKVL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 80/360 (22%)
FAA_hydrolase 86..290 CDD:279845 68/302 (23%)
FahNP_058877.1 fum_ac_acetase 2..416 CDD:162276 84/370 (23%)
FAA_hydrolase_N 15..118 CDD:286391 13/56 (23%)
FAA_hydrolase 124..390 CDD:279845 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.