DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and FAH

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_000128.1 Gene:FAH / 2184 HGNCID:3579 Length:419 Species:Homo sapiens


Alignment Length:409 Identity:85/409 - (20%)
Similarity:137/409 - (33%) Gaps:151/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KGDLAKRLGLLSEDQ---KSLVE--FAGLEGVPSDLKIL-----IAQDPNLEE---LAKKAEKQP 65
            :||...|:|:...||   .|:::  |.|        .:|     :...|.|..   |.:.|.|:.
Human    25 RGDPRPRIGVAIGDQILDLSIIKHLFTG--------PVLSKHQDVFNQPTLNSFMGLGQAAWKEA 81

  Fly    66 RL-----------EVNDD-------------VTLLPPLTDPGKIICIGLNYQDHCDEQNKPTPKE 106
            |:           .:.||             .|:..|.|       || :|.|....:...|...
Human    82 RVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPAT-------IG-DYTDFYSSRQHATNVG 138

  Fly   107 PLFFSKFNNALV-----------GPQDNVI---------------------AHAASSKIDWEVEL 139
            .:|..| .|||:           |...:|:                     .:.|...:|.|:|:
Human   139 IMFRDK-ENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEM 202

  Fly   140 VCVIG---KVARQVPKSQAMDYVFGYSVAQDISARDWQKERNG--GQFLMGKS-----------M 188
            ...:|   ::...:|.|:|.:::||..:..|.||||.||....  |.|| |||           |
Human   203 AFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFL-GKSFGTTVSPWVVPM 266

  Fly   189 DTFLPLG-----------PAVVHKSLVPDVYNLNLKTWVNGVEKQNGNT---GNLIFKLDDVINR 239
            |..:|..           |.:.|..  |..:::||...:.|.......|   .|..:....::.:
Human   267 DALMPFAVPNPKQDPRPLPYLCHDE--PYTFDINLSVNLKGEGMSQAATICKSNFKYMYWTMLQQ 329

  Fly   240 LS----QTITLLPGDIIVTGTPKG-----------VGMHRTPP---------EFLQPGDVV---- 276
            |:    ....|.|||::.:||..|           :....|.|         :||..||.|    
Human   330 LTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITG 394

  Fly   277 ----QSEIVGLGKLCNKIV 291
                ....:|.|:...|::
Human   395 YCQGDGYRIGFGQCAGKVL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 76/381 (20%)
FAA_hydrolase 86..290 CDD:279845 63/297 (21%)
FAHNP_000128.1 fum_ac_acetase 2..416 CDD:162276 85/409 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.