DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and fahd-1

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_498715.1 Gene:fahd-1 / 176109 WormBaseID:WBGene00022798 Length:214 Species:Caenorhabditis elegans


Alignment Length:196 Identity:69/196 - (35%)
Similarity:111/196 - (56%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KIICIGLNYQDHCDEQNKPTPKEPLFFSKFNNALVGPQDNVIAHAASSKIDWEVELVCVIGKVAR 148
            ||:|:|.||:||..|.....||:|:.|.|..|:.:...:.::|......:..||||..||.|.|.
 Worm    13 KIVCVGRNYKDHALELGNAIPKKPMLFVKTVNSFIVEGEPIVAPPGCQNLHQEVELGVVISKKAS 77

  Fly   149 QVPKSQAMDYVFGYSVAQDISARDWQKE--RNGGQFLMGKSMDTFLPLGPAVVHKSLVPDVYNLN 211
            ::.||.||||:.||:||.|::|||:|.|  :.|..:.:.||.|...|:| ..:..|.:|:.:::.
 Worm    78 RISKSDAMDYIGGYTVALDMTARDFQDEAKKAGAPWFLAKSFDGSCPIG-GFLPVSDIPNPHDVE 141

  Fly   212 LKTWVNGVEKQNGNTGNLIFKLDDVINRLSQTITLLPGDIIVTGTPKGVGMHRTPPEFLQPGDVV 276
            |...:||.::|...|..:||.:..::...:|..||..||:::||||.||..       :..|||:
 Worm   142 LFCKINGKDQQRCRTDVMIFDIPTLLEYTTQFFTLEVGDVVLTGTPAGVTK-------INSGDVI 199

  Fly   277 Q 277
            :
 Worm   200 E 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 69/196 (35%)
FAA_hydrolase 86..290 CDD:279845 67/194 (35%)
fahd-1NP_498715.1 MhpD <13..203 CDD:223257 69/196 (35%)
FAA_hydrolase 15..204 CDD:279845 67/194 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.