DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6028 and fah

DIOPT Version :9

Sequence 1:NP_651002.3 Gene:CG6028 / 42589 FlyBaseID:FBgn0038924 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001107523.1 Gene:fah / 100135385 XenbaseID:XB-GENE-964392 Length:420 Species:Xenopus tropicalis


Alignment Length:354 Identity:79/354 - (22%)
Similarity:125/354 - (35%) Gaps:131/354 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILIAQDPNLEELAKKAEKQPRLEVND-DVTLLPPLTDPGKIICIGLNYQDHCDEQNKPTPKEPL 108
            |:|.|.:|.|.:   .||.:.|..|:. ..||..|..       || :|.|....::..|....:
 Frog    87 KLLSASEPLLRD---NAELRSRAFVSQAKATLHLPAN-------IG-DYTDFYSSRDHATNVGIM 140

  Fly   109 FFSKFNNALV-----------GPQDNVIAHA---------------------ASSKIDWEVELVC 141
            |..| :|||:           |...:|:...                     ||..:|.|:|:..
 Frog   141 FRGK-DNALMPNWLHLPVGYHGRASSVVVSGTPVRRPMGQVRPNDDKPPEFEASKLLDIELEMAF 204

  Fly   142 VIG---KVARQVPKSQAMDYVFGYSVAQDISARDWQKERNGGQFLMGKSMDTFLPLGP------- 196
            .:|   .:.:.:|..:|.:::||..:..|.||||.||..             ::||||       
 Frog   205 FVGPGNPLGKPIPIHKADEHIFGMVLMNDWSARDIQKWE-------------YVPLGPFLSKNFS 256

  Fly   197 ------AVVHKSLVPDV---------------------YNLNLKTWVNGVEKQNGNT---GNLIF 231
                  .|..::|:|.|                     :::||...:.|...:|..:   .|..:
 Frog   257 TTISPWVVPMEALMPFVLPNTVQDPLPLPYLRDNTNYTFDINLCVCLQGKGMKNPVSICKSNFKY 321

  Fly   232 KLDDVINRLS-QTIT---LLPGDIIVTGTPKG-----------VGMHRTPP---------EFLQP 272
            ....:..:|: .|:|   :.|||::.:||..|           :....|.|         .|||.
 Frog   322 MYWTMKQQLAHHTVTGCNVRPGDLLASGTISGPDPGSFGSMLELSWRGTKPIDLGDGHKRTFLQD 386

  Fly   273 GDVV------QSE--IVGLGKLCNKIVAP 293
            ||.|      |.|  .||.| .|...|.|
 Frog   387 GDTVIIEGYCQGEGYRVGFG-TCTGTVLP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6028NP_651002.3 MhpD 37..293 CDD:223257 78/352 (22%)
FAA_hydrolase 86..290 CDD:279845 65/307 (21%)
fahNP_001107523.1 fum_ac_acetase 2..416 CDD:162276 79/354 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.