DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL35 and mrpl35

DIOPT Version :10

Sequence 1:NP_651001.2 Gene:mRpL35 / 42588 FlyBaseID:FBgn0038923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001017111.1 Gene:mrpl35 / 549865 XenbaseID:XB-GENE-1005153 Length:197 Species:Xenopus tropicalis


Alignment Length:57 Identity:16/57 - (28%)
Similarity:23/57 - (40%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 FGAGEWDARLLIERSVAIKCPSIQYHLAGTKKVQQALAKPDVLRRFVGDDAPKIEAI 397
            |..|....|:|..:.:|...|...|||     :::|:|....|.|...|...|...|
 Frog    65 FVTGNKILRILKSKGLAPDLPEDLYHL-----IKKAVAVRKHLERNRKDKDAKFRLI 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL35NP_651001.2 Ribosomal_L35p 84..144 CDD:460273
mrpl35NP_001017111.1 Ribosomal_L35p 111..170 CDD:460273 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.