DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL35 and mrpl-35

DIOPT Version :9

Sequence 1:NP_651001.2 Gene:mRpL35 / 42588 FlyBaseID:FBgn0038923 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_497724.2 Gene:mrpl-35 / 187375 WormBaseID:WBGene00010812 Length:158 Species:Caenorhabditis elegans


Alignment Length:111 Identity:41/111 - (36%)
Similarity:61/111 - (54%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QLPGVLAATG---TPSNTRNVTKFSLVKGKRKTVKAVLKRFKRLDWGAWIRTHSGRQKKLFKKSA 120
            |.|..|||.|   .|::..:: :|....|:::..:.||.|||||:.|.||..|.||.|..:.|..
 Worm    15 QAPITLAARGIANIPAHEYHI-RFDQKVGRKRPAQDVLDRFKRLNNGMWIHAHPGRHKLRYMKDE 78

  Fly   121 ALRRRLKQHVFTNATQSWLLDKMVTSYWRRPKHFINDPYKPYHSRN 166
            ..::....:......|..:|||::|.||.||||:.||||..|:.|:
 Worm    79 TWQKTSLYYETCTKEQCEILDKLMTPYWLRPKHYPNDPYSAYNVRH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL35NP_651001.2 Ribosomal_L35p 84..144 CDD:279904 20/59 (34%)
mrpl-35NP_497724.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3856
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1333597at2759
OrthoFinder 1 1.000 - - FOG0006134
OrthoInspector 1 1.000 - - oto19290
orthoMCL 1 0.900 - - OOG6_109479
Panther 1 1.100 - - LDO PTHR15909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2759
SonicParanoid 1 1.000 - - X4424
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.