DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitofilin and F36D4.6

DIOPT Version :9

Sequence 1:NP_001262819.1 Gene:Mitofilin / 42587 FlyBaseID:FBgn0019960 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001294716.2 Gene:F36D4.6 / 24104545 WormBaseID:WBGene00018091 Length:91 Species:Caenorhabditis elegans


Alignment Length:74 Identity:17/74 - (22%)
Similarity:31/74 - (41%) Gaps:16/74 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VITYAKYDDDFRKL------VEKNVPGAGSVIKVALQEEPPFKGITKNVNDQIDKV--------- 136
            ::..|:.|.:..||      .|.|:.|.|...::. ...|..|...:.:::::|:|         
 Worm    19 LLRMAEKDGEAEKLARAELITEANLGGQGETTQLN-PLVPVSKATAEKLSNELDEVGRNRTARWS 82

  Fly   137 KSGIETVTS 145
            |||...|.|
 Worm    83 KSGRTCVVS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitofilinNP_001262819.1 Mitofilin 68..739 CDD:286774 17/74 (23%)
F36D4.6NP_001294716.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1854
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073064at2759
OrthoFinder 1 1.000 - - FOG0005100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.