powered by:
Protein Alignment Mitofilin and F36D4.6
DIOPT Version :9
Sequence 1: | NP_001262819.1 |
Gene: | Mitofilin / 42587 |
FlyBaseID: | FBgn0019960 |
Length: | 746 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001294716.2 |
Gene: | F36D4.6 / 24104545 |
WormBaseID: | WBGene00018091 |
Length: | 91 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 31/74 - (41%) |
Gaps: | 16/74 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 VITYAKYDDDFRKL------VEKNVPGAGSVIKVALQEEPPFKGITKNVNDQIDKV--------- 136
::..|:.|.:..|| .|.|:.|.|...::. ...|..|...:.:::::|:|
Worm 19 LLRMAEKDGEAEKLARAELITEANLGGQGETTQLN-PLVPVSKATAEKLSNELDEVGRNRTARWS 82
Fly 137 KSGIETVTS 145
|||...|.|
Worm 83 KSGRTCVVS 91
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mitofilin | NP_001262819.1 |
Mitofilin |
68..739 |
CDD:286774 |
17/74 (23%) |
F36D4.6 | NP_001294716.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1854 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1073064at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005100 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.