DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitofilin and eya3

DIOPT Version :9

Sequence 1:NP_001262819.1 Gene:Mitofilin / 42587 FlyBaseID:FBgn0019960 Length:746 Species:Drosophila melanogaster
Sequence 2:XP_012811691.1 Gene:eya3 / 100038206 XenbaseID:XB-GENE-486218 Length:574 Species:Xenopus tropicalis


Alignment Length:304 Identity:58/304 - (19%)
Similarity:101/304 - (33%) Gaps:88/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PPFKGITKNVNDQIDKVKSGIETVTSTVDSVTSKVTGLFGGGSGDDKSKKSKV---EPVKATPAE 181
            |||..:...:     |.:||:....|....:||         ||...|:.|.|   .||:|:...
 Frog   123 PPFGALWPGI-----KSESGLIQTPSPPAVLTS---------SGVSSSQSSPVLYSYPVQASTTN 173

  Fly   182 EKRPSKPSEVSKTEAKPVSK--------------------------PAAAAA---------PAPA 211
            ....|.||.::......|:.                          |:|.|:         |:..
 Frog   174 ASTMSSPSTIANISIPTVTNISNQDYPTYTILGQNQYPQCYPNQGFPSAVASSNAEANSVTPSFP 238

  Fly   212 AKPKDNPLPRDVVELEKAIELSAQLAVKEYNVAIGVLKGFNDDVRKVVDKAVENGENSLWTTLKN 276
            |...:||:|..|          :|..:...|.|...:      :|....|..|. :|.....:||
 Frog   239 ADKAENPVPAQV----------SQRPLTGDNAAGQPM------MRATGSKETEE-QNKKTVPVKN 286

  Fly   277 RASARDTAVATAERAARE------AQEKIVACEIALSAAATAQNAKKVEAVRDKIKKLVDHIGNV 335
            |...:....::.:.:..|      ..|.|    |...:..|...|:|.    .|...||...|..
 Frog   287 RGKGKKADASSPQHSDLERVFLWDLDETI----IIFHSLLTGSYAQKY----GKDPSLVVESGLA 343

  Fly   336 KDE-LYRHKDTASVSDKYWRNVEKARNYFIDEIESIFPGLSLAD 378
            .:| ::...||    ..::.::|:.....::::.|...|..|::
 Frog   344 MEEMIFEVADT----HLFFNDLEECDQVHVEDVASDDNGQDLSN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitofilinNP_001262819.1 Mitofilin 68..739 CDD:286774 58/304 (19%)
eya3XP_012811691.1 Herpes_BLLF1 <93..301 CDD:282904 40/208 (19%)
HAD_Eya 303..574 CDD:319789 18/93 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1854
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.