DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and LYS12

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_012172.1 Gene:LYS12 / 854714 SGDID:S000001356 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:379 Identity:117/379 - (30%)
Similarity:181/379 - (47%) Gaps:58/379 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSLHT-TSTLRATDNYGANRT-TCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPV- 80
            ||:.| .|..|...:..|.:: |..||||||:|.|::.:.::|              |..:|.. 
Yeast     3 RSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQV--------------LENLNSKH 53

  Fly    81 -LSAKLEDVVASIQKNKVCIKGVLATPDY-----------SNVGDLQTLNMK----------LRN 123
             ||....|:.|..|..:...|   |.||.           :..|.:|:...|          ||.
Yeast    54 GLSFNFIDLYAGFQTFQETGK---ALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRR 115

  Fly   124 DLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEH---ESVPG--IVECLKIITAKKS 183
            ::.|:|||..|:|:.|.|.:  .||.||:||.||..|..:|.   :...|  :.:..|.|:...:
Yeast   116 EMGLFANVRPVKSVEGEKGK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIAT 178

  Fly   184 MRIAKFAFDYATKNQRKK----VTAVHKANIMKLGDGLFLRSCEEV----SRLYPRIQFEKMIVD 240
            .|||..|.|.|.|..:.:    :|..||:|::...||||...|:||    ...|.:|::.:.|||
Yeast   179 RRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVD 243

  Fly   241 NTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVG 305
            :...::...|..|||:|.|||||.|:.:.|:.|||..|||..|:...|.|:.|| ...:..:..|
Yeast   244 SMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAG 307

  Fly   306 KNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQSTTQ 359
            |.:|||.|.:.....:|..:......:.|..|::..|.:|.::|.||||:::||
Yeast   308 KGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKASTQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 111/360 (31%)
LYS12NP_012172.1 LeuB 21..371 CDD:223549 111/361 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.