DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and IDH2

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_014779.1 Gene:IDH2 / 854303 SGDID:S000005662 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:372 Identity:147/372 - (39%)
Similarity:223/372 - (59%) Gaps:26/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TFMQAAAARSLHTT---STLRAT--DNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFE 70
            ||.:..:.|.|.|.   |..|.|  .|....:.|.:.|.|||:|||:..|::::|.||:||:::|
Yeast     5 TFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVPIEWE 69

  Fly    71 -CYFLSEINPV----LSAKLEDVVASIQKNKVCIKGVLATPDYSNVG-DLQTLNMKLRNDLDLYA 129
             |    :::|:    |:...:..|.||.||.|.:||.||||    :| ..::||:.||....|:|
Yeast    70 SC----DVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATP----IGKGHRSLNLTLRKTFGLFA 126

  Fly   130 NVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYA 194
            ||...:|:.|.||.:.|:|.|:|||.||||||.:||...||:|:.:|:||...|.|:.::||:||
Yeast   127 NVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA 191

  Fly   195 TKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFD--VMV 257
            ....|.:|..|||:.|.:|.||||:...:|:|:.||.:..|..::||:.:::|:||:.:.  |.|
Yeast   192 RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256

  Fly   258 TPNLYGAIVDNLASGL-VGGAGVVAGASYSSESVVFEPGARHTFA-EAVGKNVANPTAMLLCGVK 320
            .|||||.|:.:|.||| .|..|:...|:...:..:||  |.|..| :..|::.|||||:||..|.
Yeast   257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFE--AVHGSAPDIAGQDKANPTALLLSSVM 319

  Fly   321 LLRHINLPTYGEIIQNAINKVLNDG-KVRTKDLGGQSTTQDFTRAII 366
            :|.|:.|..:.:.||||:...:..| :.||.||.|.:||..||.|:|
Yeast   320 MLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 138/341 (40%)
IDH2NP_014779.1 LeuB 34..369 CDD:223549 138/343 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.