DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and LEU2

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_009911.2 Gene:LEU2 / 850342 SGDID:S000000523 Length:364 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:95/352 - (26%)
Similarity:176/352 - (50%) Gaps:33/352 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LIPGDGVGPELVYSLQEVFKAAS-----VPVDFECYFL--SEINPVLSAKLEDVVASIQKNKVCI 99
            ::|||.||.|:.....:|.||.|     |..|||.:.:  :.|:.......::.:.:.:|....:
Yeast     9 VLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKADAVL 73

  Fly   100 KGVLATPDY--SNVGDLQTLNMKLRNDLDLYANV-------VHVRSLPGVKTRHT-NIDTVIIRE 154
            .|.:..|.:  .:|...|.| :|:|.:|.||||:       ..:..|..:|.:.. ..|.|::||
Yeast    74 LGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRE 137

  Fly   155 QTEGEY-SALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRK-KVTAVHKANIMKLGDGL 217
            ...|.| ...:.:...|:....:..|..:..||.:.|...|.:::.. .:.::.|||:: ....|
Yeast   138 LVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVL-ASSRL 201

  Fly   218 FLRSCEE-VSRLYPRIQFEKMIVDNTTMQMVSNPNQFD-VMVTPNLYGAIVDNLASGLVGGAGVV 280
            :.::.|| :...:|.::.:..::|:..|.:|.||...: :::|.|::|.|:.:.||.:.|..|::
Yeast   202 WRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLL 266

  Fly   281 AGASYSS---ESVVF---EPGARHTFAEAVGKNVANPTAMLLCGVKLLR-HINLPTYGEIIQNAI 338
            ..||.:|   ::..|   ||  .|..|..:.||..||.|.:|....:|: .:|||..|:.|::|:
Yeast   267 PSASLASLPDKNTAFGLYEP--CHGSAPDLPKNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAV 329

  Fly   339 NKVLNDGKVRTKDLGGQSTTQDFTRAI 365
            .|||:.| :||.||||.::|.:...|:
Yeast   330 KKVLDAG-IRTGDLGGSNSTTEVGDAV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 95/352 (27%)
LEU2NP_009911.2 leuB 6..359 CDD:272939 95/352 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.