DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and IMD3

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001322636.1 Gene:IMD3 / 840006 AraportID:AT1G31180 Length:419 Species:Arabidopsis thaliana


Alignment Length:347 Identity:99/347 - (28%)
Similarity:168/347 - (48%) Gaps:43/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RTTCTLIPGDGVGPELVYSLQEVFKAA----SVPVDF-ECYFLSEINPVLSAKL-EDVVASIQKN 95
            |...||:||||:|||::...:.|.:.|    .:..|| |..|......::...| |:...:.:::
plant    58 RYNITLLPGDGIGPEVISVAKNVLQKAGFLQGLEFDFQEMPFGGAALDLVGVPLPEETSTAAKQS 122

  Fly    96 KVCIKGVLATPDYSN-----VGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHT-------NID 148
            ...:.|.:....:..     ..::..||  :|.||:::||:.....||.:....|       .:|
plant   123 DAILLGAIGGYKWDKNEKHLRPEMGLLN--IRRDLNVFANLRPATVLPQLVDASTLKKEVAQGVD 185

  Fly   149 TVIIREQTEGEY-----SALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKA 208
            .:|:||.|.|.|     ....:|:...:....:|..|.:..|||:.||:.|.| :|.|:.:|.||
plant   186 MMIVRELTGGIYFGEPRGITINENGEEVGFNTEIYAAHEIDRIARVAFETARK-RRGKLCSVDKA 249

  Fly   209 NIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGL 273
            |::. ...|:.:....::..||.::...|.|||..||:|.:|.|||.:||.|::|.|:.:.||.:
plant   250 NVLD-ASILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTNNIFGDILSDEASMI 313

  Fly   274 VGGAGVVAGASY-SSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYG------ 331
            .|..|::..||. .|...:||| ...:..:..|::.|||.|.:|....||:      ||      
plant   314 TGSIGMLPSASLGESGPGLFEP-IHGSAPDIAGQDKANPLATILSAAMLLK------YGLGEEKA 371

  Fly   332 -EIIQNAINKVLNDGKVRTKDL 352
             ::|::|:...||.| .||.|:
plant   372 AKMIEDAVVDALNKG-FRTGDI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 99/347 (29%)
IMD3NP_001322636.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.