DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and IDH-V

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_568113.1 Gene:IDH-V / 831884 AraportID:AT5G03290 Length:374 Species:Arabidopsis thaliana


Alignment Length:377 Identity:168/377 - (44%)
Similarity:245/377 - (64%) Gaps:19/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSMLA----RTVGRTFMQ---AAAARSLHTTSTLRATDNYGANRT--TCTLIPGDGVGPELVYSL 56
            |:|.|    |.:|....|   |..:.|...:|..||   :.::.|  |.||.||||:|||:..|:
plant     1 MTMAANLARRLIGNRSTQILGAVNSSSGAASSVARA---FCSSTTPITATLFPGDGIGPEIAESV 62

  Fly    57 QEVFKAASVPVDFECYFL-SEINPVLSAKLE-DVVASIQKNKVCIKGVLATPDYSNVG-DLQTLN 118
            ::||..|.||:::|.::: :||:|...:.|. :.:.|:::|||.:||.:|||    :| ..::||
plant    63 KKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRNKVGLKGPMATP----IGKGHRSLN 123

  Fly   119 MKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKS 183
            :.||.:|:|||||....||||.|||:.::|.:.|||.||||||.|||:.|.|:||.|||||.:.|
plant   124 LTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEHQVVRGVVESLKIITRQAS 188

  Fly   184 MRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVS 248
            :|:|::||.||..:.|::|:|:||||||:..|||||:.|.||:..||.|.:|::::||..|.:|.
plant   189 LRVAEYAFLYAKTHGRERVSAIHKANIMQKTDGLFLKCCREVAEKYPEITYEEVVIDNCCMMLVK 253

  Fly   249 NPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTA 313
            ||..|||:|.|||||.|:.:|.:|||||.|:....:...:.|........:..:..|||:|||||
plant   254 NPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSCNIGEDGVALAEAVHGSAPDIAGKNLANPTA 318

  Fly   314 MLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQSTTQDFTRAI 365
            :||.||.:|||:......|.|.:||...:.:||.||.||||.|||.:||:||
plant   319 LLLSGVMMLRHLKFNEQAEQIHSAIINTIAEGKYRTADLGGSSTTTEFTKAI 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 157/334 (47%)
IDH-VNP_568113.1 PLN00118 3..374 CDD:215062 167/375 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.