DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and idh3g

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001025597.1 Gene:idh3g / 594985 XenbaseID:XB-GENE-492840 Length:395 Species:Xenopus tropicalis


Alignment Length:335 Identity:176/335 - (52%)
Similarity:239/335 - (71%) Gaps:7/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLSAK--LEDVVASIQKN 95
            || .|.|.|:|||||:||||:..::|||:.:.||:|||   :..:|...:.:  :::.:.:|::|
 Frog    52 YG-GRHTVTMIPGDGIGPELMLHVKEVFRHSCVPIDFE---VVNVNSTSNDEDDIQNAITAIRRN 112

  Fly    96 KVCIKGVLATPDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEY 160
            :|.:||.:.| :::.....::.|..||..|||||||:|.||:|||:|||.:||.:|:||.|||||
 Frog   113 RVALKGNIET-NHNMPPSHRSRNNLLRTSLDLYANVIHCRSVPGVQTRHKDIDIMIVRENTEGEY 176

  Fly   161 SALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEV 225
            |:||||||.|:||.|||||...|:|||::||..|.:..|||:|||||||||||||||||..|:||
 Frog   177 SSLEHESVSGVVESLKIITRANSLRIAEYAFKLAREEGRKKITAVHKANIMKLGDGLFLACCKEV 241

  Fly   226 SRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESV 290
            :..||.|.||.|||||||||:||||.||||||.|||||.||:|:.:|||||.|:|.||:|.:...
 Frog   242 ASGYPDITFESMIVDNTTMQLVSNPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVPGANYGNVYA 306

  Fly   291 VFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQ 355
            |||...|:|......||:||||||||....:|.|:.|.:|...|:.||...:|:.::.|.|:|||
 Frog   307 VFETATRNTGKSIANKNIANPTAMLLASCMMLDHLKLHSYAASIRKAILGSMNEHRMHTADIGGQ 371

  Fly   356 STTQDFTRAI 365
            .||.:..::|
 Frog   372 GTTSEVVQSI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 174/331 (53%)
idh3gNP_001025597.1 mito_nad_idh 53..385 CDD:272942 175/334 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.