DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and idh3a

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_957245.2 Gene:idh3a / 393926 ZFINID:ZDB-GENE-040426-1007 Length:365 Species:Danio rerio


Alignment Length:335 Identity:147/335 - (43%)
Similarity:206/335 - (61%) Gaps:17/335 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLSAK--------LEDVVASIQKN 95
            |.|||||||:|||:..::.::|:||..|:.:|     |.| |.:.|        ..:...|:.||
Zfish    32 TVTLIPGDGIGPEISTAVMKIFEAAKTPIQWE-----ERN-VTAIKGPGGRWMIPPEAKESMDKN 90

  Fly    96 KVCIKGVLATPDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEY 160
            |:.:||.|.||   ......::|:.||...||||||....|:.|.||.:|::|.|.|||.|||||
Zfish    91 KIGLKGPLKTP---IAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVDLVTIRENTEGEY 152

  Fly   161 SALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEV 225
            |.:||..|.|:|:.:|:||.:.|.|||::||:||..|||..||||||||||::.||||||.|.||
Zfish   153 SGIEHVIVDGVVQSIKLITEEASRRIAEYAFEYARNNQRTSVTAVHKANIMRMSDGLFLRKCREV 217

  Fly   226 SRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESV 290
            :..:..::|.:|.:|...:.||.:|:||||:|.|||||.|:.:|.:||:||.||....:..:..|
Zfish   218 AENFKDVKFTEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGV 282

  Fly   291 VFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQ 355
            ........|..:..||::|||||:||..|.:|||:.|..:.:.|:.|....:.|.||.||||||.
Zfish   283 AIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLHGHAKKIETACFDTIRDKKVLTKDLGGN 347

  Fly   356 STTQDFTRAI 365
            |...:||..|
Zfish   348 SKCSEFTADI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 147/335 (44%)
idh3aNP_957245.2 mito_nad_idh 29..361 CDD:272942 147/335 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.