DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and IDH3G

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_004126.1 Gene:IDH3G / 3421 HGNCID:5386 Length:393 Species:Homo sapiens


Alignment Length:364 Identity:186/364 - (51%)
Similarity:247/364 - (67%) Gaps:25/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ARSLHTTSTLRATDNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLS 82
            :|::.:..|:..:..|| .|.|.|:|||||:||||:..::.||:.|.||||||     |::...:
Human    36 SRNIFSEQTIPPSAKYG-GRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFE-----EVHVSSN 94

  Fly    83 AKLEDV---VASIQKNKVCIKGVLAT-----PDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPG 139
            |..||:   :.:|::|:|.:||.:.|     |.:      ::.|..||..|||||||:|.:||||
Human    95 ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSH------KSRNNILRTSLDLYANVIHCKSLPG 153

  Fly   140 VKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTA 204
            |.|||.:||.:|:||.||||||:||||||.|:||.|||||..||:|||::||..|.::.||||||
Human   154 VVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTA 218

  Fly   205 VHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNL 269
            |||||||||||||||:.|.||:..||:|.||.|||||||||:||.|.||||||.|||||.||:|:
Human   219 VHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNV 283

  Fly   270 ASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEII 334
            .:|||||.|:||||:|.....|||...|:|......||:|||||.||....:|.|:.|.:|...|
Human   284 CAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSI 348

  Fly   335 QNAINKVLNDGKVRTKDLGGQSTT----QDFTRAI-ILN 368
            :.|:...:::..:.|.|:|||.||    ||..|.| ::|
Human   349 RKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVIN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 182/345 (53%)
IDH3GNP_004126.1 mito_nad_idh 52..383 CDD:272942 181/342 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.