DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and IDH3A

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_005521.1 Gene:IDH3A / 3419 HGNCID:5384 Length:366 Species:Homo sapiens


Alignment Length:343 Identity:144/343 - (41%)
Similarity:207/343 - (60%) Gaps:11/343 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RATDNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINP-----VLSAKLED 87
            :.|..:.....|.|||||||:|||:..::.::|.||..|:.:|...::.|..     ::.::.::
Human    22 QVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKE 86

  Fly    88 VVASIQKNKVCIKGVLATPDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVII 152
               |:.|||:.:||.|.||   ......::|:.||...||||||....|:.|.||.:|:::.|.|
Human    87 ---SMDKNKMGLKGPLKTP---IAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI 145

  Fly   153 REQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGL 217
            ||.||||||.:||..|.|:|:.:|:||...|.|||:|||:||..|.|..||||||||||::.|||
Human   146 RENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGL 210

  Fly   218 FLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAG 282
            ||:.|.||:.....|:|.:|.:|...:.||.:|:||||:|.|||||.|:.:|.:||:||.||...
Human   211 FLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPS 275

  Fly   283 ASYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKV 347
            .:..:..|........|..:..||::|||||:||..|.:|||:.|..:...|:.|....:.|||.
Human   276 GNIGANGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKS 340

  Fly   348 RTKDLGGQSTTQDFTRAI 365
            .||||||.:...|||..|
Human   341 LTKDLGGNAKCSDFTEEI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 143/334 (43%)
IDH3ANP_005521.1 mito_nad_idh 29..362 CDD:272942 143/336 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.