DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and CG32026

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:341 Identity:132/341 - (38%)
Similarity:213/341 - (62%) Gaps:20/341 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLSEINPVLSAK-----LEDVVASIQKNKVCIK 100
            ||:||||:|||:..::.::.:||..|:.||..   ::.|||:::     .|.|:.|:.:.||.:|
  Fly   386 TLMPGDGIGPEISMAVIKILEAAKTPLIFEPV---DVTPVLNSQGMTSVPEQVIESMNRTKVGLK 447

  Fly   101 GVLATPDYSNVG-DLQTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALE 164
            |.|.||    || ..::||:.||...:||||:...||||||:|.:.::|.|.|||.||||||.:|
  Fly   448 GPLMTP----VGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIE 508

  Fly   165 HESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLY 229
            |..|.|:|:.:|:||...|:|:|::.|.||...:|||||||.::.:|::.||||||...|::..|
  Fly   509 HTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKY 573

  Fly   230 PR------IQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSE 288
            ..      |::|:..:....:.:|.:|.::|::|.|||||.|:.:..:||:||.|:....:..:.
  Fly   574 KSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTN 638

  Fly   289 SVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLG 353
            ..:|| ....|..:..||::|||||:||..|.:|.:|.|..:.:.|:.|:.|.:.|..:||.|||
  Fly   639 GAIFE-SVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLG 702

  Fly   354 GQSTTQDFTRAIILNM 369
            |::...::|.|:|.|:
  Fly   703 GKAKCSEYTDALIKNL 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 131/339 (39%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 131/339 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469786
Domainoid 1 1.000 180 1.000 Domainoid score I145
eggNOG 1 0.900 - - E1_COG0473
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I184
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 1 1.000 - - otm51400
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11835
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.