DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and 4933405O20Rik

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_766489.1 Gene:4933405O20Rik / 243996 MGIID:2142174 Length:396 Species:Mus musculus


Alignment Length:357 Identity:167/357 - (46%)
Similarity:236/357 - (66%) Gaps:16/357 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSLHTTSTLRATDNYGANRTTCTLIPGDGVGPELVYSLQEVFKAASVPVDFECYFLS------EI 77
            ||..:...:..:..|| .|.|..:|||||:||||:..::::|::..||||||..:::      ||
Mouse    34 RSFCSHCAVPPSPKYG-GRHTVAMIPGDGIGPELMVHVKKIFRSNCVPVDFEEVWVTSTSNEEEI 97

  Fly    78 NPVLSAKLEDVVASIQKNKVCIKGVLATPDYSNVGDLQTLNMKLRNDLDLYANVVHVRSLPGVKT 142
            |..|.|        |::|:|.:||.:|| :::.....::.|.|.|..|||||:|||.::.|||.|
Mouse    98 NNALMA--------IRRNRVALKGNIAT-NHNLPARYKSHNTKFRTILDLYASVVHFKTFPGVMT 153

  Fly   143 RHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKSMRIAKFAFDYATKNQRKKVTAVHK 207
            ||.:||.:::||.|||||:.||||||.|:||.|||:|..||:|||.:||..|.|..|||||.|||
Mouse   154 RHKDIDILVVRENTEGEYTNLEHESVKGVVESLKIVTKTKSVRIADYAFKLAQKMGRKKVTVVHK 218

  Fly   208 ANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASG 272
            ||||||||||||:.|::|:..||:|..|.||:||||||:||.|.||||||.|||||.|::::.:|
Mouse   219 ANIMKLGDGLFLQCCKDVAAHYPQITLESMIIDNTTMQLVSKPQQFDVMVMPNLYGNIINSICTG 283

  Fly   273 LVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNA 337
            ||||:|:|.||:|.....:||.|::....:...:|:|||.||||....:|.:::|..|...|::|
Mouse   284 LVGGSGIVPGANYGDSYAIFEMGSKEIGKDLAHRNIANPVAMLLTSCIMLDYLDLQPYATHIRSA 348

  Fly   338 INKVLNDGKVRTKDLGGQSTTQDFTRAIILNM 369
            :...|.:..|.|.|:|||..|......|:.:|
Mouse   349 VMASLQNKAVCTPDIGGQGNTASTVEYILHHM 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 162/337 (48%)
4933405O20RikNP_766489.1 Iso_dh 49..380 CDD:294303 163/340 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.