DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idh3b and LOC100125384

DIOPT Version :9

Sequence 1:NP_001163682.1 Gene:Idh3b / 42586 FlyBaseID:FBgn0038922 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001096833.1 Gene:LOC100125384 / 100125384 RGDID:1642415 Length:395 Species:Rattus norvegicus


Alignment Length:381 Identity:166/381 - (43%)
Similarity:241/381 - (63%) Gaps:31/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTFMQAA---------------AARSLHTTSTLRATDNYGANRTTCTLIPGDGVGPELVYSLQEV 59
            ||.:|.|               :.|:..:..::..:..||...|. |:|||||:||||:..::.:
  Rat    10 RTILQPALLLGHSREVVCELVTSFRNFCSKYSVPPSPKYGGKHTV-TMIPGDGIGPELMVHVKRI 73

  Fly    60 FKAASVPVDFECYFLS------EINPVLSAKLEDVVASIQKNKVCIKGVLATPDYSNVGDLQTLN 118
            |::..|||:||..:.:      |||..|.|        |::|::.:||.:|| ::......::.|
  Rat    74 FRSNCVPVEFEEVWATSTSSEEEINNALMA--------IRRNRITLKGNIAT-NHHLPAKYKSHN 129

  Fly   119 MKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVECLKIITAKKS 183
            .|.|..|||||:|||.::.|||:|||.:||.:::||.|||||:.||||||.|:||.|||:|..||
  Rat   130 TKFRTALDLYASVVHFKTFPGVETRHKDIDILVVRENTEGEYTNLEHESVRGVVESLKIVTKTKS 194

  Fly   184 MRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQFEKMIVDNTTMQMVS 248
            :|||.:||..|.|..|||||.|||||||||||||||:.|::|:..||:|..|.||:|||.||:||
  Rat   195 VRIADYAFRLAQKMGRKKVTVVHKANIMKLGDGLFLQCCKDVAAHYPQITLESMIIDNTAMQLVS 259

  Fly   249 NPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEPGARHTFAEAVGKNVANPTA 313
            .|.|||||:.|||||.|::::.:|||||:|:|.||:|.....:||.|::....:...:|:|||.|
  Rat   260 KPQQFDVMLMPNLYGNIINSVCTGLVGGSGIVPGANYGDSYAIFETGSKEIGQDLAHRNIANPVA 324

  Fly   314 MLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGGQSTTQDFTRAIILNM 369
            |||....:|.:::|..|...|::|:...|.:..:.|.|:|||.||......|:.:|
  Rat   325 MLLTSCIMLDYLDLQLYAAHIRSAVMASLQNKSICTPDIGGQGTTAGVVEYILDHM 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idh3bNP_001163682.1 Iso_dh 37..369 CDD:294303 158/337 (47%)
LOC100125384NP_001096833.1 Iso_dh 49..380 CDD:294303 159/340 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.