DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Theg and theg

DIOPT Version :9

Sequence 1:NP_650999.1 Gene:Theg / 42585 FlyBaseID:FBgn0038921 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001104306.1 Gene:theg / 561308 ZFINID:ZDB-GENE-070912-59 Length:239 Species:Danio rerio


Alignment Length:236 Identity:61/236 - (25%)
Similarity:91/236 - (38%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 IEKLAKPK----------------KAPKVPKPDRGAGEFDPVRLNQLASPKA---YLEEIK---- 219
            |::|||||                :.|..||....|.|..| ||.:|...|.   :.|:.:    
Zfish     5 IDQLAKPKTNLLKFPDRRSVYWLDELPSRPKSSTTAFETTP-RLEKLVQSKRPIHFYEDNRRSVE 68

  Fly   220 ---------------------PK-----WE--------LTSQMKDYKATKRI------KQISQPV 244
                                 |:     |:        |:..:|..|.:.||      |||...:
Zfish    69 WVVSAAALKACPSQRVCSLALPRPPADGWQPDRPLMDTLSVAVKTAKPSPRICYLAQPKQIKMTL 133

  Fly   245 VRDNVHINENPEKVSPNALRYKPSARIKEMSEPLTTRDANQGLADVKENPFGIAPNALKYKASTR 309
            ...:|..:|:...:|..     ||||:..::.|......:.....|.   :.|..:.||..||.|
Zfish   134 THFSVESSEHEIGISTT-----PSARLLRLASPKQVHPQHTLARSVS---WPIPKHVLKAGASER 190

  Fly   310 IKELAEPKEFENTHIRENPFAISPAALKAKASPRLIELAKP 350
            ::.||.||..:......||:.:||||..|.|||||:||:.|
Zfish   191 LQVLARPKTRQALFEGYNPYRVSPAAGSATASPRLLELSLP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThegNP_650999.1 THEG 222..277 CDD:291573 16/68 (24%)
THEG 296..351 CDD:291573 25/55 (45%)
thegNP_001104306.1 THEG <44..91 CDD:291573 6/47 (13%)
THEG 69..127 CDD:291573 7/57 (12%)
THEG 151..198 CDD:291573 14/49 (29%)
THEG 176..231 CDD:291573 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009662
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.