DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Theg and THEG

DIOPT Version :9

Sequence 1:NP_650999.1 Gene:Theg / 42585 FlyBaseID:FBgn0038921 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_011526351.1 Gene:THEG / 51298 HGNCID:13706 Length:447 Species:Homo sapiens


Alignment Length:350 Identity:79/350 - (22%)
Similarity:116/350 - (33%) Gaps:125/350 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IGQELDKLTRRHERMFVKRRRLMEMAIP---------RRRTCRFVPKCACSFPKSIEMVRPCDAQ 101
            |.|:|...|....|...:||||||:|.|         |:..|          .|....:.||...
Human   143 ISQKLPSTTMTKARKRRRRRRLMELAEPKINWQVLKDRKGRC----------GKGYAWISPCKMS 197

  Fly   102 NHTRTEQLALPTVRRLLHRRRTAILAGDSIGESILNRWLRYSYLSLYSRLTNIQPLVKPKKKKKK 166
            .|.   .|..|:|                       .|.                          
Human   198 LHF---CLCWPSV-----------------------YWT-------------------------- 210

  Fly   167 TEKQLAKHEKYIEKLAKPKKAPKVPKPDRGAGEFDPVRLNQLASPKA-YLE-----EIKPKWELT 225
                    |:::|........|.|.:           |:.:|:.||. |||     ...|.|.:.
Human   211 --------ERFLEDTTLTITVPAVSR-----------RVEELSRPKRFYLEYYNNNRTTPVWPIP 256

  Fly   226 SQMKDYKATKRIKQISQPVVRDNVHINENPE--KVSPNALRYKPSARIKEMSEPLTTRDANQGLA 288
            ....:|:|:.|:|:::.|.:|||.......|  :||..|....||:||.::|:|.......:...
Human   257 RSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATLLEEWD 321

  Fly   289 DV-KENPFGIAPNALKY--KASTRIKELAEPKEFENTHIR----------ENPFAISPAAL---- 336
            .| |..|.....|.|.:  :||::.:..:..|.....|:|          |.|.|.|...:    
Human   322 PVPKPKPHVSDHNRLLHLARASSQSQGWSAKKWVALIHLRRSSTQRGIWKEGPKAQSDKCVPDRD 386

  Fly   337 ----------KAKASPRLIELAKPK 351
                      |..||||:|.|||||
Human   387 PRWEVLDVTKKVVASPRIISLAKPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThegNP_650999.1 THEG 222..277 CDD:291573 18/56 (32%)
THEG 296..351 CDD:291573 20/80 (25%)
THEGXP_011526351.1 THEG <227..275 CDD:291573 13/58 (22%)
THEG 253..311 CDD:291573 18/57 (32%)
THEG 291..341 CDD:291573 14/49 (29%)
THEG <374..411 CDD:291573 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009662
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.