DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Theg and Theg

DIOPT Version :9

Sequence 1:NP_650999.1 Gene:Theg / 42585 FlyBaseID:FBgn0038921 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006240919.1 Gene:Theg / 299599 RGDID:1309240 Length:378 Species:Rattus norvegicus


Alignment Length:337 Identity:84/337 - (24%)
Similarity:132/337 - (39%) Gaps:109/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DAQNHTRTEQLA---LPTVRRLLHRRRTAILAGDSIGESILNRWLRYSYLSLYSRLTNIQPLVKP 160
            |.:.....|::.   ||.|..|          .||:...:....:..|:||:..|.|......|.
  Rat    61 DPEEEIPPEEMVGEELPEVSNL----------EDSLRRDLEVEVVGMSHLSINERTTPTTSSAKC 115

  Fly   161 KKKKKKTEKQLAK------------------H----------------------EKYIEKLAKPK 185
            :|||.....:|||                  |                      |::||......
  Rat   116 RKKKNHRLLELAKPKFNWQCLKDRTGRCCKGHVWISPRKTNLQFCLYWPSVYWTERFIEDTTLTI 180

  Fly   186 KAPKVPKPDRGAGEFDPVRLNQLASPKAYLEE------IKPKWELTSQMKDYKATKRIKQISQPV 244
            ..|:|.:           |:.:|:.||.:.:|      ..|.|.:.....:|:|:.|:|:::.|.
  Rat   181 TVPEVSR-----------RVEELSRPKRFYQEYYNNNRTTPIWPIPRSTLEYQASNRLKRLATPK 234

  Fly   245 VRDNVHINENPEKVS------------PNALRY-KP--SARIKEMSEPLT-----TRDANQ--GL 287
            :|:|:. :.|..:||            |..||. ||  .|.:.|..:|:.     ..|.|:  .|
  Rat   235 IRNNIW-SINMSEVSQVSRAAQMAVPTPRTLRLAKPRAPATLLEEWDPMPKPKPYVSDYNRLLQL 298

  Fly   288 ADVK---------ENP----FGIAPNALKYKASTRIKELAEPKEFENTHIRENPFAISPAALKAK 339
            |..|         .:|    ..:..||:   ||:||..||:||..::.:...||:.||||:|.|:
  Rat   299 ATPKALSEKCVPDRSPQWEVLNVTKNAV---ASSRIISLAQPKIRKDLNEGYNPYYISPASLVAQ 360

  Fly   340 ASPRLIELAKPK 351
            ||||:.|||.||
  Rat   361 ASPRIYELAVPK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThegNP_650999.1 THEG 222..277 CDD:291573 18/69 (26%)
THEG 296..351 CDD:291573 25/54 (46%)
ThegXP_006240919.1 THEG <186..234 CDD:291573 16/62 (26%)
THEG 212..270 CDD:291573 20/92 (22%)
THEG 250..338 CDD:291573 30/77 (39%)
THEG 316..372 CDD:291573


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5301
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009662
OrthoInspector 1 1.000 - - oto97376
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15901
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.950

Return to query results.
Submit another query.