DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Theg and Theg

DIOPT Version :9

Sequence 1:NP_650999.1 Gene:Theg / 42585 FlyBaseID:FBgn0038921 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_035713.1 Gene:Theg / 21830 MGIID:1338756 Length:375 Species:Mus musculus


Alignment Length:297 Identity:77/297 - (25%)
Similarity:115/297 - (38%) Gaps:111/297 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SYLSLYSRLTNIQPLVKPKKKKKKTEKQLAKHEKYIEKLAKPKKA-------------------- 187
            |:||:..|    .|.|...|.:||..::|.       :|||||..                    
Mouse    96 SHLSITER----TPSVSTAKGRKKRSRRLL-------ELAKPKTNWQCLRDRTGRCCKGYAWISP 149

  Fly   188 -----------PKVPKPDRGAGEFD-----PV---RLNQLASPKAYLEE------IKPKWELTSQ 227
                       |.|...:|...:..     ||   |:.:|:.||.:.:|      ..|.|.:...
Mouse   150 RKTNLQFCLYWPSVYWTERFIEDTTLTITVPVVSQRMEELSRPKRFYQEYYNNNRTTPIWSIPRS 214

  Fly   228 MKDYKATKRIKQISQPVVRDNVHINENPEKVS------------PNALRY---KPSARIKEMSEP 277
            ..:|:|:.|:||::.|.||:|:. :.|..:||            |..||.   :|.|.:.|..:|
Mouse   215 TLEYQASNRLKQLATPKVRNNIW-SINMSEVSQVSRAAQMAVPTPRTLRLAKPRPPATLLEEWDP 278

  Fly   278 LTTRDANQGLADVKENPFG---------IAPNALKYK-------------------ASTRIKELA 314
            :.           |..|:.         ..|.||..|                   ||:||..||
Mouse   279 MP-----------KPKPYVSDYNRLLQLATPKALSEKCVPDRSPQWEVLDVTKNAVASSRIISLA 332

  Fly   315 EPKEFENTHIRENPFAISPAALKAKASPRLIELAKPK 351
            :||..::.:...||:.||||:|.|:||||:.|||.||
Mouse   333 QPKIRKDLNEGYNPYYISPASLVAQASPRIYELATPK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThegNP_650999.1 THEG 222..277 CDD:291573 19/69 (28%)
THEG 296..351 CDD:291573 27/82 (33%)
ThegNP_035713.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
THEG 1 110..129 5/18 (28%)
THEG 2 176..195 5/18 (28%)
THEG <183..231 CDD:291573 18/62 (29%)
THEG 209..267 CDD:291573 19/100 (19%)
THEG 3 214..233 6/21 (29%)
THEG 247..335 CDD:291573 30/86 (35%)
THEG 4 250..269 10/37 (27%)
THEG 5 282..301 11/18 (61%)
THEG 313..369 CDD:291573
THEG 6 318..337
THEG 7 352..371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009662
OrthoInspector 1 1.000 - - oto93836
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.