DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Theg and THEGL

DIOPT Version :9

Sequence 1:NP_650999.1 Gene:Theg / 42585 FlyBaseID:FBgn0038921 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_011532659.1 Gene:THEGL / 100506564 HGNCID:43771 Length:486 Species:Homo sapiens


Alignment Length:320 Identity:79/320 - (24%)
Similarity:119/320 - (37%) Gaps:96/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PKSIEMVRPCDAQNHTRTEQLALPTVRRLLHRRRTAIL--AGDSIGESILNRWLRYSYLS-LYSR 150
            ||.::...|...: |||..       |:....:.|.:|  |...|..|::.|......|| |.:.
Human   110 PKLLKAREPRQLR-HTREP-------RKSREAKETELLPSAAVMISPSLITRAPPRPQLSFLGAN 166

  Fly   151 LTNIQPLVKPKKKKKKTEKQLAKHEKYIEKLAKPKKAPKVPKPDRGA--GEFDPV---------- 203
            ..:...:.|....:|:|           ..|:||||  :...|||..  |..||:          
Human   167 PVSCDFVRKCFSSRKRT-----------PNLSKPKK--QWGTPDRKLFWGNQDPIRPVSQGALKA 218

  Fly   204 ----RLNQLASPKAYLEEIKPK--------------WELTSQMKDYKATKRIKQISQP------- 243
                ||..||.||.......|.              ||:|......:.:|||:::|||       
Human   219 QLTKRLENLAQPKEVSCHYVPNRAQYYHSCGRESVIWEITPPALFRQPSKRIQRLSQPNGFKRQC 283

  Fly   244 ---------VVRDNVHINENPEKVSPNALRYKPSARIKEMSEPLTTRDANQGLADVKENPFGIAP 299
                     ..||::.|::             ||.||.::|   ..:..:......|:....|:.
Human   284 LLNRPFSDNSARDSLRISD-------------PSPRILQLS---VAKGTDPNYHPSKKMQTKISL 332

  Fly   300 NALKYKASTRIKELAEPK--------EFENTHIRENPFAISPAALKAKASPRLIELAKPK 351
            :.|...|:.||.|||.|:        |.:.:.:...|  :.|||:.||.|||.|.|||.|
Human   333 STLSAIATPRIIELAHPRIKLEGLCYERQRSELPIRP--VPPAAMIAKPSPRTIALAKSK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThegNP_650999.1 THEG 222..277 CDD:291573 17/70 (24%)
THEG 296..351 CDD:291573 23/62 (37%)
THEGLXP_011532659.1 THEG 175..231 CDD:291573 18/68 (26%)
THEG 210..277 CDD:291573 15/66 (23%)
THEG 255..311 CDD:291573 16/68 (24%)
THEG 330..390 CDD:291573 23/61 (38%)
THEG 369..426 CDD:291573 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.