DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RCCD1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:403 Identity:126/403 - (31%)
Similarity:172/403 - (42%) Gaps:87/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFNAFGQHECVSGDVDCAAGFSELNAPVSTQNQCTISIGWRYAA-LAFGRKLCLRGLLDDGPNEC 70
            ||..||| |..||........|.|.|.|..   |.:|..|.|.| :..|.:|.|.|........|
Human    13 GFCGFGQ-ELGSGRGRQVHSPSPLRAGVDI---CRVSASWSYTAFVTRGGRLELSGSASGAAGRC 73

  Fly    71 VTLEATGNIRALAAADSHCLVLLQ---SGQLYRVQPKLQAELVAVRLEA----APRSNSGTKRSI 128
            ....|:..:.|:..|......|||   :....|.:| |.|:.|....|.    |..:.:| :..:
Human    74 KDAWASEGLLAVLRAGPGPEALLQVWAAESALRGEP-LWAQNVVPEAEGEDDPAGEAQAG-RLPL 136

  Fly   129 FGAAKA---PSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLN 190
            ...|:|   |.:|....:|                           .:.|.:||:.|.|||:||:
Human   137 LPCARAYVSPRAPFYRPLA---------------------------PELRARQLELGAEHALLLD 174

  Fly   191 ANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCS 255
            |.|.||:||.|..||||...|..|..|:|||||.|:.:.::|||||||..:|..||:|.||.|.|
Human   175 AAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGLVMAEVAAGGWHSVCVSETGDIYIWGWNES 239

  Fly   256 GQL------------------------GLRVMKPGGVLK-EPTVF----PLPQLQDLPECACSQS 291
            |||                        |.:|.:.||... .|..|    |.|.|.|||       
Human   240 GQLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGAPAPFIAVQPFPALLDLP------- 297

  Fly   292 GESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALE-GITMNPTV 355
              ...|.  ::...|||||.::.|.|.|:..||.|:||||.  :|.:.:|..:.:| .:.....|
Human   298 --MGSDA--VKASCGSRHTAVVTRTGELYTWGWGKYGQLGH--EDTTSLDRPRRVEYFVDKQLQV 356

  Fly   356 DDVLCGPWSTLLH 368
            ..|.||||:|.::
Human   357 KAVTCGPWNTYVY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 103/331 (31%)
RCC1_2 176..205 CDD:290274 15/28 (54%)
RCC1 192..241 CDD:278826 26/48 (54%)
RCC1_2 228..257 CDD:290274 15/28 (54%)
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 45/188 (24%)
ATS1 <156..340 CDD:227511 76/196 (39%)
RCC1 2 176..227 26/50 (52%)
RCC1 3 229..317 28/98 (29%)
RCC1 4 318..371 19/54 (35%)
RCC1 319..366 CDD:395335 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 1 1.000 - - FOG0003064
OrthoInspector 1 1.000 - - oto89820
orthoMCL 1 0.900 - - OOG6_108718
Panther 1 1.100 - - LDO PTHR46849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3591
SonicParanoid 1 1.000 - - X3975
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.