DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HERC3

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:342 Identity:91/342 - (26%)
Similarity:151/342 - (44%) Gaps:59/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WRYAALAF-GRKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAEL 109
            |.|.:|.. |....|:|::.: |..|..: :..:::.:|...:|.:.||:.|::|......:.:|
Human     4 WGYWSLGQPGISTNLQGIVAE-PQVCGFI-SDRSVKEVACGGNHSVFLLEDGEVYTCGLNTKGQL 66

  Fly   110 VAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYS------------- 161
                    .....|.|....||.   :...|.|:|||...::|:|....::|             
Human    67 --------GHEREGNKPEQIGAL---ADQHIIHVACGESHSLALSDRGQLFSWGAGSDGQLGLMT 120

  Fly   162 ------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQL 219
                  :|..:.:.:::  .:.|:.||:.|.:.|.|:|..||||....|||||. |...:.:||.
Human   121 TEDSVAVPRLIQKLNQQ--TILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQASPQR 183

  Fly   220 LEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLP 284
            :.:|.||.:.|:||||.||.|:|..|.::.||:|.:|||||...|.   .:.|....|.:.|.:.
Human   184 VRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKD---RESPCHVKLLRTQKVV 245

  Fly   285 ECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALEGI 349
            ..:|                 |..||.::.:.|.::..|....||||....: ..|:..:.||  
Human   246 YISC-----------------GEEHTAVLTKSGGVFTFGAGSCGQLGHDSMN-DEVNPRRVLE-- 290

  Fly   350 TMNPTVDDVLCGPWSTL 366
            .|...|..:.||...||
Human   291 LMGSEVTQIACGRQHTL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 83/309 (27%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 23/49 (47%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
HERC3NP_055421.1 RCC1 1 1..51 11/48 (23%)
ATS1 2..331 CDD:227511 91/342 (27%)
RCC1 2 52..101 13/59 (22%)
RCC1 3 102..154 7/53 (13%)
RCC1 4 156..207 24/50 (48%)
RCC1 5 208..259 17/70 (24%)
RCC1 6 261..311 15/50 (30%)
RCC1 313..377 CDD:366085
RCC1 7 313..366
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.