DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and SRM1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_011418.1 Gene:SRM1 / 852782 SGDID:S000003065 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:67/300 - (22%)
Similarity:114/300 - (38%) Gaps:68/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PNECVTLEATGN-IRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFG 130
            |.|.....|.|: :..|||.|:....|..:|::|              .....|.|.|.......
Yeast   154 PRESFPPLAEGHKVVQLAATDNMSCALFSNGEVY--------------AWGTFRCNEGILGFYQD 204

  Fly   131 AAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDV 195
            ..|...:|                     :.:|:    ||  ::.:.||..|.:|.:.|:..|.|
Yeast   205 KIKIQKTP---------------------WKVPT----FS--KYNIVQLAPGKDHILFLDEEGMV 242

  Fly   196 FTWGNGLRGQLG---LAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQ 257
            |.||||.:.|||   :...|::........|..:|  .||:|..|..|::....|.:||||..||
Yeast   243 FAWGNGQQNQLGRKVMERFRLKTLDPRPFGLRHVK--YIASGENHCFALTKDNKLVSWGLNQFGQ 305

  Fly   258 LGL-RVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWV 321
            .|: ..::.|.::.:|....||                 |:.....:.||..|:|::.:.|.|:.
Yeast   306 CGVSEDVEDGALVTKPKRLALP-----------------DNVVIRSIAAGEHHSLILSQDGDLYS 353

  Fly   322 SGWCKHGQLG---RQLQDLSYVDAFQALEGITMNPTVDDV 358
            .|.....::|   ..|.:.:|.|.......:.:...:::|
Yeast   354 CGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNNV 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 62/288 (22%)
RCC1_2 176..205 CDD:290274 12/28 (43%)
RCC1 192..241 CDD:278826 17/51 (33%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
SRM1NP_011418.1 ATS1 15..477 CDD:227511 66/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.