DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and FMP25

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_013178.1 Gene:FMP25 / 850766 SGDID:S000004067 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:67/283 - (23%)
Similarity:93/283 - (32%) Gaps:92/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ERQFRVKQLQCGHEHAVLLNANGDVFTWGNG--------LRGQLGLAEL-RVEETP---QL--LE 221
            |.:.||.|...|..|.|||:..|..:....|        .:||.|:... :.:|.|   ||  :|
Yeast   292 EGEKRVVQFDAGSHHLVLLSNLGKAYCCATGNDQKQAQVSKGQFGIPTFSQFDEFPPNNQLFEIE 356

  Fly   222 ALAGIK-----------ITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVF 275
            .|...|           |.:||.|.:|:.||...|::|.:|.|..|||.|    |.....|...|
Yeast   357 LLNKFKHEGEDVVRKREIKKIACGSYHTLAIDKTGEIYAFGWNRFGQLAL----PISYNLEYVSF 417

  Fly   276 P-------LPQLQDLPECAC------------------SQS------------GE------SNDD 297
            |       .|....:....|                  |.|            ||      .|..
Yeast   418 PRSVTHAFKPHFPGMTNWKCVDIHCDDETSFVTIRKPGSTSDHHYFAFGNGLFGELGNNTFKNSQ 482

  Fly   298 CAPLRVFAGSRHTLLIRRCGR--------------LWVSGWCKHGQLGRQLQDLSYVDAFQALEG 348
            |.|:::.:..: .|....||.              .|  |...|||||...:.:.........| 
Yeast   483 CDPIKIKSDDK-KLTNWSCGSHCVFTETEQENEVIAW--GNNDHGQLGIGKKTMKCAKPMNIPE- 543

  Fly   349 ITMNPTVDDV-LCGPWSTLLHLK 370
             .:.|..|.. |...:::.||||
Yeast   544 -VLKPGQDTTDLDSIYNSKLHLK 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 67/283 (24%)
RCC1_2 176..205 CDD:290274 9/36 (25%)
RCC1 192..241 CDD:278826 17/73 (23%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
FMP25NP_013178.1 ATS1 8..577 CDD:227511 67/283 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003064
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3591
SonicParanoid 1 1.000 - - X3975
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.