DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and PRAF1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_565144.1 Gene:PRAF1 / 844030 AraportID:AT1G76950 Length:1103 Species:Arabidopsis thaliana


Alignment Length:259 Identity:69/259 - (26%)
Similarity:107/259 - (41%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NSGTKRSIFGAAKAPSSPIIE-----HIACGSHINVAISSENCVY-------SIPSCLHQFSERQ 173
            :|....|..|:|...|..:.:     .:.|.:.:.|.| .:|..|       .:|..|.  |...
plant   219 SSAQSSSSHGSAADDSDALGDVYIWGEVICDNVVKVGI-DKNASYLTTRTDVLVPKPLE--SNIV 280

  Fly   174 FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEAL-AGIKITQIAAGGWH 237
            ..|.|:.||..||..:...|::||||....|:||....:....|:|:|:| |...:..:|.|.:|
plant   281 LDVHQIACGVRHAAFVTRQGEIFTWGEESGGRLGHGIGKDVFHPRLVESLTATSSVDFVACGEFH 345

  Fly   238 SAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLR 302
            :.|::..|:||||| :.:..:||                |....|:......:...|.:......
plant   346 TCAVTLAGELYTWG-DGTHNVGL----------------LGHGSDISHWIPKRIAGSLEGLHVAS 393

  Fly   303 VFAGSRHTLLIRRCGRLWVSGWCKHGQLGR-QLQDLSYVDAFQALEGITMNPTVDDVLCGPWST 365
            |..|..||.||...|||:..|....|.||. ..:.:.|....::|.|:.   |: .|.||.|.|
plant   394 VSCGPWHTALITSYGRLFTFGDGTFGVLGHGDKETVQYPREVESLSGLR---TI-AVSCGVWHT 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 69/259 (27%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 16/49 (33%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
PRAF1NP_565144.1 PH_PLC_plant-like 14..124 CDD:270171
ATS1 238..628 CDD:227511 64/240 (27%)
FYVE 627..695 CDD:214499
COG1340 <828..909 CDD:224259
BRX_N 879..>908 CDD:404581
BRX 1022..1077 CDD:400608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.