DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT1G69710

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_177129.2 Gene:AT1G69710 / 843307 AraportID:AT1G69710 Length:1041 Species:Arabidopsis thaliana


Alignment Length:255 Identity:65/255 - (25%)
Similarity:109/255 - (42%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IACGSHINVAISSENCVYSIPSCLHQF-------------------SERQFRVKQLQCGHEHAVL 188
            :|||.....||:....:||.....|..                   ..:...|..:.||..|..:
plant   357 LACGDFHTCAITQSGDLYSWGDGTHNVDLLGHGNESSCWIPKRVTGDLQGLYVSDVACGPWHTAV 421

  Fly   189 LNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAI------------ 241
            :.::|.:||:|:|..|.||..:.|....|:.:|:|.|:.:|::|.|.||:||:            
plant   422 VASSGQLFTFGDGTFGALGHGDRRSTSVPREVESLIGLIVTKVACGVWHTAAVVEVTNEASEAEV 486

  Fly   242 -SAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFA 305
             |:.|.::|||....||||     .|.          ...:.||||..|.:.|  :.|   :|..
plant   487 DSSRGQVFTWGDGEKGQLG-----HGD----------NDTKLLPECVISLTNE--NIC---QVAC 531

  Fly   306 GSRHTLLIRRC--GRLWVSGWCKHGQLGRQLQDLSYVDAFQALEGITMNPTVDDVLCGPW 363
            |  |:|.:.|.  |.::..|...:||||......::.   :.:||..:..:|:::.||.:
plant   532 G--HSLTVSRTSRGHVYTMGSTAYGQLGNPTAKGNFP---ERVEGDIVEASVEEIACGSY 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 65/255 (25%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 19/48 (40%)
RCC1_2 228..257 CDD:290274 12/41 (29%)
AT1G69710NP_177129.2 PH_PLC_plant-like 25..135 CDD:270171
RCC1_2 354..381 CDD:290274 7/23 (30%)
RCC1 370..422 CDD:278826 7/51 (14%)
RCC1 425..474 CDD:278826 19/48 (40%)
RCC1 491..537 CDD:278826 20/67 (30%)
RCC1 543..591 CDD:278826 11/47 (23%)
RCC1 596..643 CDD:278826
FYVE 646..714 CDD:214499
DUF4200 838..936 CDD:290574
BRX_N 896..>921 CDD:290432
BRX 981..1035 CDD:285568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.