DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and EEA1

DIOPT Version :10

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_011537116.1 Gene:EEA1 / 8411 HGNCID:3185 Length:1453 Species:Homo sapiens


Alignment Length:133 Identity:30/133 - (22%)
Similarity:50/133 - (37%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QNQCTISIGWRYAALAFGRKLC-LRGLLDDGPNECVTLEAT--GNIRALAAADSHCLVLLQSGQL 98
            :|..|:...|:.:.    |::. |....||...|...||||  .|.....|....|  |...|::
Human  1290 ENLGTVKKEWQSSQ----RRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERC--LKGEGEI 1348

  Fly    99 YRVQPK---LQAEL--VAVRLEAAPRSNSGTK---RSIFGAAKAPSSPIIEHIACGSHINVAISS 155
            .::|.|   ||.:|  ....::...|.|...:   ........|..:.:...:|||...:|.:..
Human  1349 EKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRR 1413

  Fly   156 ENC 158
            .:|
Human  1414 HHC 1416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 175..>331 CDD:444065
EEA1XP_011537116.1 GumC <117..>349 CDD:442439
SMC_prok_B <285..1006 CDD:274008
SMC_prok_B 651..>1382 CDD:274008 24/97 (25%)
FYVE_EEA1 1389..1451 CDD:277269 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.