DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT1G27060

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_174026.1 Gene:AT1G27060 / 839595 AraportID:AT1G27060 Length:386 Species:Arabidopsis thaliana


Alignment Length:353 Identity:83/353 - (23%)
Similarity:132/353 - (37%) Gaps:99/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WRYAALAFGRKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYR---------- 100
            |.:.|...| :|....|.|:...:.::|.:..:|..||...:|.:.|...|:::.          
plant    18 WSWGAGTDG-QLGTTKLQDELLPQLLSLTSLPSISMLACGGAHVIALTSGGKVFTWGRGSSGQLG 81

  Fly   101 -------VQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENC 158
                   ..|||.                    |.|      ...:|...|.|...:..:|...|
plant    82 HGDILNITLPKLV--------------------SFF------DDSVITQAAAGWSHSGFVSDSGC 120

  Fly   159 VY------------------SIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQ 205
            ::                  |.|:.:..|:...  ||.:.||..|:::|.|...|..:|:|.|||
plant   121 IFTCGNGSFGQLGHGDTLSLSTPAKVSHFNNDS--VKMVACGMRHSLVLFAGNQVCGFGSGKRGQ 183

  Fly   206 LGLAELRVEET--PQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLN-CSG----------- 256
            ||.:..|::..  |.::..|..:::.:|:|.|.|||||||.|..::||.. |.|           
plant   184 LGFSSDRIKSVNLPCVVSGLKDVEVVRISANGDHSAAISADGQFFSWGRGFCGGPDVHAPQSLPS 248

  Fly   257 QLGLR-----------------VMKPGGVL-KEPTVFPLPQLQDLPECACSQSGESNDDCAPLRV 303
            .|..|                 |.|.|..| |:|   ...|||.....|..:.....|....:::
plant   249 PLSFREVAVGWNHALLLTVDGEVFKLGSTLNKQP---EKQQLQIDSSEALFEKVPDFDGVKVMQI 310

  Fly   304 FAGSRHTLLIRRCGRLWVSGWCKHGQLG 331
            .||:.|:..:...|.:...||.:|||||
plant   311 AAGAEHSAAVTENGEVKTWGWGEHGQLG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 76/321 (24%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 17/50 (34%)
RCC1_2 228..257 CDD:290274 15/40 (38%)
AT1G27060NP_174026.1 ATS1 17..379 CDD:227511 83/353 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.