DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT1G19880

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_173417.2 Gene:AT1G19880 / 838576 AraportID:AT1G19880 Length:538 Species:Arabidopsis thaliana


Alignment Length:226 Identity:54/226 - (23%)
Similarity:85/226 - (37%) Gaps:67/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 CGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFG 245
            |...|.|.|:..|..:|||...:||||..::...:.|.::..|:..||.:.|||..|:..:|..|
plant    65 CASFHCVALDVEGRCYTWGRNEKGQLGHGDMIQRDRPTVVSGLSKHKIVKAAAGRNHTVVVSDDG 129

  Fly   246 DLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLP-------------------------------- 278
            ....:|.|..|||||...|.|.|..|....|||                                
plant   130 QSLGFGWNKYGQLGLGSAKNGFVSVEVESTPLPCVVSDEVTNVACGADFTVWLSSTEGASILTAG 194

  Fly   279 --------------------------QLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCG 317
                                      :.|..|:...|.:||:     .::|..|:.||:.:.:.|
plant   195 LPQYGQLGHGTDNEFNMKDSSVRLAYEAQPRPKAIASLAGET-----IVKVACGTNHTVAVDKNG 254

  Fly   318 RLWVSGWCKHGQLGRQLQDLSY----VDAFQ 344
            .::..|:..:|:||.:.|...:    :|.||
plant   255 YVYTWGFGGYGRLGHREQKDEWAPRRIDVFQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 54/226 (24%)
RCC1_2 176..205 CDD:290274 8/23 (35%)
RCC1 192..241 CDD:278826 16/48 (33%)
RCC1_2 228..257 CDD:290274 9/28 (32%)
AT1G19880NP_173417.2 ATS1 38..384 CDD:227511 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.